KCC000172A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000172A_C02 KCC000172A_c02
ttcaTACACTCCCAGCCCTTGCATAGTCAGGGTACCAGTTTTGCAAAAATGAGACGCAGC
GCTGCTCGCCTGCTGCGTGGCGTTGGCCAGGCGGTCGCCCGCTCGGGCGAGGTCGCCGAG
GCGTCGGCTGTGAAGCTGTTCGACATCAACGCCAGCCGTGGACTGTCGGCGCAGACGTTG
AGCATGCTCGGCGCTCTGAGCCATGCGGCCACGCCCCTGCCGAGCGGCTTCGCTGCCAGC
GGTATCCGCTCCATTTCGGTCGCGGCGCTGCAGCCGAGCGATGACTTCAAGCCGCGCCAC
AACAGCGGCACGCCCGCGGAAATTGACTCCATGGTCAAGGCCACGGGCTTCGGCTCGCTG
GACGCACTCATTGATGCAACGGTGCCCAAGGCGATCGTGCGCAAGGACGGCATGAACCTG
GGCAAGTACCACGAGGGCATGACCGAGAGCCAGTTCCTGGAGTACTTCAAGGCCATGGCC
AGCAAGAACAAGGTGTACAAGTCGTACATCGGCATGGGCTACTACGGGACGCACGTGCCC
AACGTCATCCTGCGCAACGTGCTGGAGAACCCCGGCTGGTACACGCAGTACACGCCCTAC
CAGGCGGAGATCGCGCAGGGCCGCCTGGAGTCGCTGCTGAACTTCCAGACGATGATCTGC
GACCTGACCGGCATGGCCATCTCCAACGCCTCGCTGCTGGACGAGGCCACGGCCGCCGCC
GAGGCCATGACCATGTGCAGCGCCATCGCGCGCGGCAAGAAGCCCAAGTTCCTGGTGTCG
AGCAAGTGCCACCCGCAGACCATTGCGGTGTGCCAGACGCGCGCTGAGGGCCTGGGCCTG
GAGGCGGTGGTGGTGGATGAGGACAAGATGGCGTACGCCAAGGACGTGTGCGGCGTGCTG
CTGCAGTACCCCGCCACGGACGGCTCCATCTCGGACTACAAGGCGCTGGTGGCGAAGGCG
CACGCCGCCAACGTCAAGGTGTGCGTGGCCACCGACCTGCTGGCGCTCACCATGCTGGCG
CCGCCCGGCGAGTGGGGCGCCGACATCGTGATCGGCAGCGCGCAGCGCTTCGGCGTGCCC
ATGGGCTACGGCGGTCCGCACGCAGCCTTCCTGGCCTGCCACGACGAGTTCAAGCGCCTC
ATGCCCGGCCGCATCATCGGCATGTCCATCGACGCGCAGGGCAAGCCCGCGCTGCGCATG
GCGATGCAGACGCGCGAGCAGCATATCCGCCGCGACAAGGCCACCTCCAACATCTGCACG
GCGCAGGCGCTGCTGGCCAACATGGCTGCGCTGTACGCGGTGTACCACGGCCCCGAGGGC
CTCAAGACCATCGCGCACCGCGTCAACGGCCTGGCGTCCGTGTTCGCCGCCGGCGCCGCC
AAGCTGGGCCACACCGTGCCGTCGGCGCCCTTCTTCGACACCGTGTCGGTCACGGTGAAG
GACGGCGACGCCGACAAGTACGTGGCGCTGGCGCTGAACGAGAAGATCAACATCCGCAAG
CTGAGCAAGAACACCATCAGCCTGGCGTTCGACGAGACCAGCTCCGTGGCGGACGTGGAC
GCGCTGCTGCGCGTGCTCAACTGCGGCCGCGACGCGCCCTTCACCGCCGCCAGCCTGGCG
CCGGCGGTTGAGGGCGGCGTGGGCGGCTTCGCGCGCAAGAGCACCTTCCTGCAGCAGCCC
ATCTTCAACACCTACCACAACGAGCACGACATGCTGCGCTACCTGAAGCGGCTGGAGAAC
AAGGACCTGTCGCTGGTGCACAGCATGATCCCCCTGGGCAGCTGCACCATGAAGCTGAAC
GCCACGGCGGAGATGATGCCCATCACCTGGCCCGAGCTGGCGGCGCTGCACCCCTTCGTG
CCCGTGGACCAGGCCGAGGGCTATGCGGAGATGTTCCGCGACCTGTCGGCGCAGCTGTGC
TCCATCACCGGCTTTGACGCCATGAGCCTGCAGCCCAACTCGGGCGCGTCCGGCGAGTAC
GCGGGCCTCATGGCCATCCGCGCCTTCCACCTGTCCCGCAACGAGGGCCACCGCAACGTG
TGCATCATCCCCGTGTCGGCGCACGGCACCAACCCCGCTTCGGCGGTGATGGCGGGCATG
AAGATCGTGACCGTGTCCACCGACAGCCAGGGCAACGTGAACATCCCGGAGCTGCGCGCC
AAGGCGGAGGAGCACAGCAAGAACCTGGCGGCGCTGATGATCACCTACCCCTCCACGCAC
GGCGTGTACGAGGACGGCGTGGACGAGATCTGCCGCATCATCCACCAGCACGGCGGCCAG
GTGTACATGGACGGAGCCAACATGAACGCGCAGGTGGGCCTGACCGCGCCCGGCCTGATC
GGCGCGGACGTGTGCCACCTCAACCTGCACAAGACCTTCTGCATCCCGCACGGCGGCGGC
GGCCCCGGCATGGGCCCCATCGGCGTCAAGGCGCACCTGGCGCCCTTCCTGCCTACGCAC
CCCGTGGTGCCCACCGGCGCGCTGCCGTACCGGGCCGTCGACTCCCAAGCCCTTCGGCAC
CATGGCGGCGGCGCCCTTCGGCTCCTCCCTCATCCTGCCCATCAGCTACGCCTACATCAG
CATGATGGGCAGC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000172A_C02 KCC000172A_c02
         (2593 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|O49850|GCSP_FLAAN Glycine dehydrogenase [decarboxylating], mi...  1063  0.0
sp|O49852|GCSP_FLATR Glycine dehydrogenase [decarboxylating], mi...  1055  0.0
sp|P49362|GCSB_FLAPR Glycine dehydrogenase [decarboxylating] B, ...  1055  0.0
sp|P49361|GCSA_FLAPR Glycine dehydrogenase [decarboxylating] A, ...  1052  0.0
emb|CAA81076.1| P protein [Flaveria pringlei]                        1051  0.0

>sp|O49850|GCSP_FLAAN Glycine dehydrogenase [decarboxylating], mitochondrial precursor
            (Glycine decarboxylase) (Glycine cleavage system
            P-protein) gi|2894358|emb|CAB16911.1| P-protein [Flaveria
            anomala]
          Length = 1034

 Score = 1063 bits (2750), Expect(2) = 0.0
 Identities = 527/811 (64%), Positives = 637/811 (77%), Gaps = 3/811 (0%)
 Frame = +1

Query: 64   ARLLRGVGQAVARSGEVAEASAVKLFDINASRGLSAQTLSMLGALSHAATPLPSGFAASG 243
            AR L  +G+ V+++      S+  L   + SR +S+ +  + G  +  +    +GF  S 
Sbjct: 4    ARRLAMLGRLVSQTKHNPSISSPAL--CSPSRYVSSLSPYVCGGTNVRSDRNLNGFG-SQ 60

Query: 244  IRSISVAALQPSDDFKPRHNSGTPAEIDSMVKATGFGSLDALIDATVPKAIVRKDGMNLG 423
            +R+ISV AL+PSD F  RHNS TP E   M +  GF +LD+LIDATVPK+I R D M   
Sbjct: 61   VRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFSNLDSLIDATVPKSI-RLDSMKYS 119

Query: 424  KYHEGMTESQFLEYFKAMASKNKVYKSYIGMGYYGTHVPNVILRNVLENPGWYTQYTPYQ 603
            K+ EG+TESQ + + + +ASKNK++KS+IGMGYY T VP VILRN++ENPGWYTQYTPYQ
Sbjct: 120  KFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMENPGWYTQYTPYQ 179

Query: 604  AEIAQGRLESLLNFQTMICDLTGMAISNASLLDEATAAAEAMTMCSAIARGKKPKFLVSS 783
            AEIAQGRLESLLNFQTMI DLTG+ +SNASLLDE TAAAEAM MC+ I +GKK  F+++S
Sbjct: 180  AEIAQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKKKTFIIAS 239

Query: 784  KCHPQTIAVCQTRAEGLGLEAVVVDEDKMAYAK-DVCGVLLQYPATDGSISDYKALVAKA 960
             CHPQTI +C+TRA+G  L+ V  D     Y+  DVCGVL+QYP T+G + DY   +  A
Sbjct: 240  NCHPQTIDICKTRADGFDLKVVTSDLKDFDYSSGDVCGVLVQYPGTEGELLDYSEFIKNA 299

Query: 961  HAANVKVCVATDLLALTMLAPPGEWGADIVIGSAQRFGVPMGYGGPHAAFLACHDEFKRL 1140
            HA  VKV +A+DLLALT+L PPGE GADIV+GSAQRFGVPMGYGGPHAAFLA   E+KR+
Sbjct: 300  HANGVKVVMASDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLATSQEYKRM 359

Query: 1141 MPGRIIGMSIDAQGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAALYAVYHGPEG 1320
            MPGRIIG+S+D+ GKPALRMAMQTREQHIRRDKATSNICTAQALLANMAA+Y VYHGPEG
Sbjct: 360  MPGRIIGVSVDSSGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAAMYGVYHGPEG 419

Query: 1321 LKTIAHRVNGLASVFAAGAAKLGHT-VPSAPFFDTVSVTVKDGDADKYVALALNEKINIR 1497
            LKTIA RV+GLA  FAAG  KLG   V   PFFDTV VT  D  A      A   K+N+R
Sbjct: 420  LKTIAKRVHGLAGTFAAGLKKLGTVQVQDLPFFDTVKVTCADSKA--IAEEACKHKMNLR 477

Query: 1498 KLSKNTISLAFDETSSVADVDALLRVLNCGRDAPFTAASLAPAVEGGV-GGFARKSTFLQ 1674
             + KNTI++AFDET+++ DVD L +V   G+  PFTAAS+AP V+  +  G  R++ +L 
Sbjct: 478  IVDKNTITVAFDETTTIEDVDTLFKVFALGKPVPFTAASIAPEVQDAIPSGLVRETPYLT 537

Query: 1675 QPIFNTYHNEHDMLRYLKRLENKDLSLVHSMIPLGSCTMKLNATAEMMPITWPELAALHP 1854
             PIFN YH EH++LRY+ +L++KDLSL HSMIPLGSCTMKLNAT EMMP+TWP  A +HP
Sbjct: 538  HPIFNMYHTEHELLRYISKLQSKDLSLCHSMIPLGSCTMKLNATTEMMPVTWPAFADIHP 597

Query: 1855 FVPVDQAEGYAEMFRDLSAQLCSITGFDAMSLQPNSGASGEYAGLMAIRAFHLSRNEGHR 2034
            F P +QA+GY EMF++L   LC+ITGFD+ SLQPN+GA+GEYAGLM IRA+H++R + HR
Sbjct: 598  FAPTEQAQGYQEMFKNLGDLLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHMARGDHHR 657

Query: 2035 NVCIIPVSAHGTNPASAVMAGMKIVTVSTDSQGNVNIPELRAKAEEHSKNLAALMITYPS 2214
            NVCIIPVSAHGTNPASA M GMKI+TV TDS+GN+NI ELR  AE + +NL+ALM+TYPS
Sbjct: 658  NVCIIPVSAHGTNPASAAMCGMKIITVGTDSKGNINIEELRKAAEANKENLSALMVTYPS 717

Query: 2215 THGVYEDGVDEICRIIHQHGGQVYMDGANMNAQVGLTAPGLIGADVCHLNLHKTFCIPHG 2394
            THGVYE+G+DEIC+IIH +GGQVYMDGANMNAQVGLT+PG IGADVCHLNLHKTFCIPHG
Sbjct: 718  THGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHG 777

Query: 2395 GGGPGMGPIGVKAHLAPFLPTHPVVPTGALP 2487
            GGGPGMGPIGVK HLAP+LP+HPVVPTG +P
Sbjct: 778  GGGPGMGPIGVKKHLAPYLPSHPVVPTGGIP 808

 Score = 51.6 bits (122), Expect(2) = 0.0
 Identities = 23/33 (69%), Positives = 28/33 (84%)
 Frame = +2

Query: 2495 PSTPKPFGTMAAAPFGSSLILPISYAYISMMGS 2593
            P   +P GT+AAAP+GS+LILPISY YI+MMGS
Sbjct: 810  PEESQPLGTIAAAPWGSALILPISYTYIAMMGS 842

>sp|O49852|GCSP_FLATR Glycine dehydrogenase [decarboxylating], mitochondrial precursor
            (Glycine decarboxylase) (Glycine cleavage system
            P-protein) gi|2894360|emb|CAB16916.1| P-Protein precursor
            [Flaveria trinervia]
          Length = 1034

 Score = 1055 bits (2729), Expect(2) = 0.0
 Identities = 514/758 (67%), Positives = 611/758 (79%), Gaps = 3/758 (0%)
 Frame = +1

Query: 223  SGFAASGIRSISVAALQPSDDFKPRHNSGTPAEIDSMVKATGFGSLDALIDATVPKAIVR 402
            +GF  S +R+ISV AL+PSD F  RHNS TP E   M +  GF +LD+LIDATVPKAI R
Sbjct: 55   NGFG-SQVRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFSNLDSLIDATVPKAI-R 112

Query: 403  KDGMNLGKYHEGMTESQFLEYFKAMASKNKVYKSYIGMGYYGTHVPNVILRNVLENPGWY 582
             D M   K+ EG+TESQ + + + +ASKNK++KS+IGMGYY T VP VILRN++ENPGWY
Sbjct: 113  LDSMKYSKFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMENPGWY 172

Query: 583  TQYTPYQAEIAQGRLESLLNFQTMICDLTGMAISNASLLDEATAAAEAMTMCSAIARGKK 762
            TQYTPYQAEIAQGRLESLLNFQTMI DLTG+ +SNASLLDE TAAAEAM MC+ I +GKK
Sbjct: 173  TQYTPYQAEIAQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKK 232

Query: 763  PKFLVSSKCHPQTIAVCQTRAEGLGLEAVVVDEDKMAYAK-DVCGVLLQYPATDGSISDY 939
              F+++S CHPQTI +C+TRA+G  L+ V  D     Y+  DVCGVL+QYP T+G + DY
Sbjct: 233  KTFIIASNCHPQTIDICKTRADGFDLKVVTSDLKDFDYSSGDVCGVLVQYPGTEGELLDY 292

Query: 940  KALVAKAHAANVKVCVATDLLALTMLAPPGEWGADIVIGSAQRFGVPMGYGGPHAAFLAC 1119
               +  AHA  VKV +A+DLLALT+L PPGE GADIV+GSAQRFGVPMGYGGPHAAFLA 
Sbjct: 293  SEFIKNAHANGVKVVMASDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLAT 352

Query: 1120 HDEFKRLMPGRIIGMSIDAQGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAALYA 1299
              E+KR+MPGRIIG+S+D+ GKPALRMAMQTREQHIRRDKATSNICTAQALLANMAA+Y 
Sbjct: 353  SQEYKRMMPGRIIGVSVDSSGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAAMYG 412

Query: 1300 VYHGPEGLKTIAHRVNGLASVFAAGAAKLGHT-VPSAPFFDTVSVTVKDGDADKYVALAL 1476
            VYHGPEGLKTIA RV+GLA  FAAG  KLG   V   PFFDTV VT  D  A      A 
Sbjct: 413  VYHGPEGLKTIAKRVHGLAGTFAAGLKKLGTVQVQDLPFFDTVKVTCADSKA--IAEEAY 470

Query: 1477 NEKINIRKLSKNTISLAFDETSSVADVDALLRVLNCGRDAPFTAASLAPAVEGGV-GGFA 1653
              K+N+R + KNTI++AFDET+++ DVD L +V   G+   FTAAS+AP V+  +  G  
Sbjct: 471  KHKMNLRIVDKNTITVAFDETTTIEDVDTLFKVFALGKPVTFTAASIAPEVQDAIPSGLV 530

Query: 1654 RKSTFLQQPIFNTYHNEHDMLRYLKRLENKDLSLVHSMIPLGSCTMKLNATAEMMPITWP 1833
            R++ +L  PIFN YH EH++LRY+ +L++KDLSL HSMIPLGSCTMKLNAT EMMP+TWP
Sbjct: 531  RETPYLTHPIFNMYHTEHELLRYISKLQSKDLSLCHSMIPLGSCTMKLNATTEMMPVTWP 590

Query: 1834 ELAALHPFVPVDQAEGYAEMFRDLSAQLCSITGFDAMSLQPNSGASGEYAGLMAIRAFHL 2013
              A +HPF P +QA+GY EMF++L   LC+ITGFD+ SLQPN+GA+GEYAGLM I+A+H+
Sbjct: 591  AFADIHPFAPTEQAQGYQEMFKNLGDLLCTITGFDSFSLQPNAGAAGEYAGLMVIQAYHM 650

Query: 2014 SRNEGHRNVCIIPVSAHGTNPASAVMAGMKIVTVSTDSQGNVNIPELRAKAEEHSKNLAA 2193
            +R + HR VCIIPVSAHGTNPASA M GMKI+TV TDS+GN+NI ELR  AE + +NL+A
Sbjct: 651  ARGDHHRKVCIIPVSAHGTNPASAAMCGMKIITVGTDSKGNINIEELRKAAEANKENLSA 710

Query: 2194 LMITYPSTHGVYEDGVDEICRIIHQHGGQVYMDGANMNAQVGLTAPGLIGADVCHLNLHK 2373
            LM+TYPSTHGVYE+G+DEIC+IIH +GGQVYMDGANMNAQVGLT+PG IGADVCHLNLHK
Sbjct: 711  LMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGWIGADVCHLNLHK 770

Query: 2374 TFCIPHGGGGPGMGPIGVKAHLAPFLPTHPVVPTGALP 2487
            TFCIPHGGGGPGMGPIGVK HLAP+LP+HPVVPTG +P
Sbjct: 771  TFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVPTGGIP 808

 Score = 51.6 bits (122), Expect(2) = 0.0
 Identities = 23/33 (69%), Positives = 28/33 (84%)
 Frame = +2

Query: 2495 PSTPKPFGTMAAAPFGSSLILPISYAYISMMGS 2593
            P   +P GT+AAAP+GS+LILPISY YI+MMGS
Sbjct: 810  PEQSQPLGTIAAAPWGSALILPISYTYIAMMGS 842

>sp|P49362|GCSB_FLAPR Glycine dehydrogenase [decarboxylating] B, mitochondrial precursor
            (Glycine decarboxylase B) (Glycine cleavage system
            P-protein B) gi|2130012|pir||S63536
            aminomethyltransferase (EC 2.1.2.10) gdcsPB precursor -
            Flaveria pringlei gi|1000489|emb|CAA91000.1| P-protein
            precursor of glycine cleavage system [Flaveria pringlei]
          Length = 1034

 Score = 1055 bits (2727), Expect(2) = 0.0
 Identities = 513/758 (67%), Positives = 612/758 (80%), Gaps = 3/758 (0%)
 Frame = +1

Query: 223  SGFAASGIRSISVAALQPSDDFKPRHNSGTPAEIDSMVKATGFGSLDALIDATVPKAIVR 402
            +GF  S +R+ISV AL+PSD F  RHNS TP E   M +  GF +LD+LIDATVPK+I R
Sbjct: 55   NGFG-SQVRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFPNLDSLIDATVPKSI-R 112

Query: 403  KDGMNLGKYHEGMTESQFLEYFKAMASKNKVYKSYIGMGYYGTHVPNVILRNVLENPGWY 582
             D M   K+ EG+TESQ + + + +ASKNK++KS+IGMGYY T VP VILRN++ENPGWY
Sbjct: 113  LDSMKYSKFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMENPGWY 172

Query: 583  TQYTPYQAEIAQGRLESLLNFQTMICDLTGMAISNASLLDEATAAAEAMTMCSAIARGKK 762
            TQYTPYQAEIAQGRLESLLNFQTMI DLTG+ +SNASLLDE TAAAEAM MC+ I +GKK
Sbjct: 173  TQYTPYQAEIAQGRLESLLNFQTMITDLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKK 232

Query: 763  PKFLVSSKCHPQTIAVCQTRAEGLGLEAVVVDEDKMAYAK-DVCGVLLQYPATDGSISDY 939
              F+++S CHPQTI +C+TRA+G  L+ V  D     Y+  DVCGVL+QYP T+G + DY
Sbjct: 233  KTFIIASNCHPQTIDICKTRADGFDLKVVTSDLKDFDYSSGDVCGVLVQYPGTEGELLDY 292

Query: 940  KALVAKAHAANVKVCVATDLLALTMLAPPGEWGADIVIGSAQRFGVPMGYGGPHAAFLAC 1119
               +  AHA  VKV +A+DLLALT+L PPGE GADIV+GSAQRFGVPMGYGGPHAAFLA 
Sbjct: 293  SEFIKNAHANGVKVVMASDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLAT 352

Query: 1120 HDEFKRLMPGRIIGMSIDAQGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAALYA 1299
              E+KR+MPGRIIG+S+D+ GKPALRMAMQTREQHIRRDKATSNICTAQALLANMAA++ 
Sbjct: 353  SQEYKRMMPGRIIGVSVDSSGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAAMFG 412

Query: 1300 VYHGPEGLKTIAHRVNGLASVFAAGAAKLGHT-VPSAPFFDTVSVTVKDGDADKYVALAL 1476
            VYHGPEGLKTIA RV+GLA  FA+G  KLG   V   PFFDTV VT  D  A      A 
Sbjct: 413  VYHGPEGLKTIAKRVHGLAGTFASGLKKLGTVQVQDLPFFDTVKVTCADSKA--IAEEAY 470

Query: 1477 NEKINIRKLSKNTISLAFDETSSVADVDALLRVLNCGRDAPFTAASLAPAVEGGV-GGFA 1653
              K+N+R + KNTI++AFDET+++ DVD L +V   G+   FTAAS+AP V+  +  G  
Sbjct: 471  KHKMNLRIVDKNTITVAFDETTTIEDVDTLFKVFALGKPVTFTAASIAPEVQDAIPSGLV 530

Query: 1654 RKSTFLQQPIFNTYHNEHDMLRYLKRLENKDLSLVHSMIPLGSCTMKLNATAEMMPITWP 1833
            R++ +L  PIFN YH EH++LRY+ +L++KDLSL HSMIPLGSCTMKLNAT EMMP+TWP
Sbjct: 531  RETPYLTHPIFNMYHTEHELLRYISKLQSKDLSLCHSMIPLGSCTMKLNATTEMMPVTWP 590

Query: 1834 ELAALHPFVPVDQAEGYAEMFRDLSAQLCSITGFDAMSLQPNSGASGEYAGLMAIRAFHL 2013
              A +HPF P +QA+GY EMF++L   LC+ITGFD+ SLQPN+GA+GEYAGLM IRA+H+
Sbjct: 591  AFADIHPFAPTEQAQGYQEMFKNLGDLLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHM 650

Query: 2014 SRNEGHRNVCIIPVSAHGTNPASAVMAGMKIVTVSTDSQGNVNIPELRAKAEEHSKNLAA 2193
            +R + HRNVCIIPVSAHGTNPASA M GMKI+TV TDS+GN+NI ELR  AE + +NL+A
Sbjct: 651  ARGDHHRNVCIIPVSAHGTNPASAAMCGMKIITVGTDSKGNINIEELRKAAEANKENLSA 710

Query: 2194 LMITYPSTHGVYEDGVDEICRIIHQHGGQVYMDGANMNAQVGLTAPGLIGADVCHLNLHK 2373
            LM+TYPSTHGVYE+G+DEIC+IIH +GGQVYMDGANMNAQVGLT+PG IGADVCHLNLHK
Sbjct: 711  LMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGWIGADVCHLNLHK 770

Query: 2374 TFCIPHGGGGPGMGPIGVKAHLAPFLPTHPVVPTGALP 2487
            TFCIPHGGGGPGMGPIGVK HLAP+LP+HPVVPTG +P
Sbjct: 771  TFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVPTGGIP 808

 Score = 51.6 bits (122), Expect(2) = 0.0
 Identities = 23/33 (69%), Positives = 28/33 (84%)
 Frame = +2

Query: 2495 PSTPKPFGTMAAAPFGSSLILPISYAYISMMGS 2593
            P   +P GT+AAAP+GS+LILPISY YI+MMGS
Sbjct: 810  PEQSQPLGTIAAAPWGSALILPISYTYIAMMGS 842

>sp|P49361|GCSA_FLAPR Glycine dehydrogenase [decarboxylating] A, mitochondrial precursor
            (Glycine decarboxylase A) (Glycine cleavage system
            P-protein A) gi|2130011|pir||S63535
            aminomethyltransferase (EC 2.1.2.10) gdcsPA precursor -
            Flaveria pringlei gi|608712|emb|CAA85353.1| P-protein of
            the glycine cleavage system [Flaveria pringlei]
          Length = 1037

 Score = 1052 bits (2720), Expect(2) = 0.0
 Identities = 512/758 (67%), Positives = 611/758 (80%), Gaps = 3/758 (0%)
 Frame = +1

Query: 223  SGFAASGIRSISVAALQPSDDFKPRHNSGTPAEIDSMVKATGFGSLDALIDATVPKAIVR 402
            +GF  S +R+ISV AL+PSD F  RHNS TP E   M +  GF +LD+LIDATVPK+I R
Sbjct: 58   NGFG-SQVRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFPNLDSLIDATVPKSI-R 115

Query: 403  KDGMNLGKYHEGMTESQFLEYFKAMASKNKVYKSYIGMGYYGTHVPNVILRNVLENPGWY 582
             D M   K+ EG+TESQ + + + +ASKNK++KS+IGMGYY T VP VILRN++ENPGWY
Sbjct: 116  LDSMKYSKFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMENPGWY 175

Query: 583  TQYTPYQAEIAQGRLESLLNFQTMICDLTGMAISNASLLDEATAAAEAMTMCSAIARGKK 762
            TQYTPYQAEIAQGRLESLLNFQTM+ DLTG+ +SNASLLDE TAAAEAM MC+ I +GKK
Sbjct: 176  TQYTPYQAEIAQGRLESLLNFQTMVTDLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKK 235

Query: 763  PKFLVSSKCHPQTIAVCQTRAEGLGLEAVVVDEDKMAYAK-DVCGVLLQYPATDGSISDY 939
              F+++S CHPQTI +C+TRA+G  L+ V  D     Y+  DVCGVL+QYP T+G + DY
Sbjct: 236  KTFIIASNCHPQTIDICKTRADGFDLKVVTSDLKDFDYSSGDVCGVLVQYPGTEGELLDY 295

Query: 940  KALVAKAHAANVKVCVATDLLALTMLAPPGEWGADIVIGSAQRFGVPMGYGGPHAAFLAC 1119
               +  AHA  VKV +A+DLLALT+L PPGE GADIV+GSAQRFGVPMGYGGPHAAFLA 
Sbjct: 296  SEFIKNAHANGVKVVMASDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLAT 355

Query: 1120 HDEFKRLMPGRIIGMSIDAQGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAALYA 1299
              E+KR+MPGRIIG+S+D+ GKPALRMAMQTREQHIRRDKATSNICTAQALLANMAA++ 
Sbjct: 356  SQEYKRMMPGRIIGVSVDSSGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAAMFG 415

Query: 1300 VYHGPEGLKTIAHRVNGLASVFAAGAAKLGHT-VPSAPFFDTVSVTVKDGDADKYVALAL 1476
            VYHGPEGLKTIA RV+GLA  FAAG  KLG   V   PFFDTV VT  D  A      A 
Sbjct: 416  VYHGPEGLKTIAKRVHGLAGTFAAGLKKLGTVQVQDLPFFDTVKVTCVDSKA--IAEEAY 473

Query: 1477 NEKINIRKLSKNTISLAFDETSSVADVDALLRVLNCGRDAPFTAASLAPAVEGGV-GGFA 1653
              K+N+R + KNTI++AFDET+++ DVD L +V   G+   FTAAS+AP V+  +  G  
Sbjct: 474  KHKMNLRIVDKNTITVAFDETTTIEDVDTLFKVFALGKPVTFTAASIAPEVQDAIPSGLV 533

Query: 1654 RKSTFLQQPIFNTYHNEHDMLRYLKRLENKDLSLVHSMIPLGSCTMKLNATAEMMPITWP 1833
            R++ +L  PIFN YH EH++LRY+ +L++KDLSL HSMIPLGSCTMKLNAT EMMP+TWP
Sbjct: 534  RETPYLTHPIFNMYHTEHELLRYISKLQSKDLSLCHSMIPLGSCTMKLNATTEMMPVTWP 593

Query: 1834 ELAALHPFVPVDQAEGYAEMFRDLSAQLCSITGFDAMSLQPNSGASGEYAGLMAIRAFHL 2013
              A +HPF P +QA+GY EMF++L   LC+ITGFD+ SLQPN+GA+GEYAGLM IRA+H+
Sbjct: 594  AFADIHPFAPTEQAQGYQEMFKNLGDLLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHM 653

Query: 2014 SRNEGHRNVCIIPVSAHGTNPASAVMAGMKIVTVSTDSQGNVNIPELRAKAEEHSKNLAA 2193
            +R + HRNVCIIPVSAHGTNPASA M GMKI+TV TDS+GN+NI ELR  AE + +NL+A
Sbjct: 654  ARGDHHRNVCIIPVSAHGTNPASAAMCGMKIITVGTDSKGNINIEELRKAAEANKENLSA 713

Query: 2194 LMITYPSTHGVYEDGVDEICRIIHQHGGQVYMDGANMNAQVGLTAPGLIGADVCHLNLHK 2373
            LM+TYPSTHGVYE+G+DEIC+IIH +GGQVYMDGANMNAQVGLT+PG IGADVCHLNLHK
Sbjct: 714  LMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGWIGADVCHLNLHK 773

Query: 2374 TFCIPHGGGGPGMGPIGVKAHLAPFLPTHPVVPTGALP 2487
            TFCIPHGGGGPGMGPIGVK HLAP+LP+HPVV TG +P
Sbjct: 774  TFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVATGGIP 811

 Score = 51.6 bits (122), Expect(2) = 0.0
 Identities = 23/33 (69%), Positives = 28/33 (84%)
 Frame = +2

Query: 2495 PSTPKPFGTMAAAPFGSSLILPISYAYISMMGS 2593
            P   +P GT+AAAP+GS+LILPISY YI+MMGS
Sbjct: 813  PEQSQPLGTIAAAPWGSALILPISYTYIAMMGS 845

>emb|CAA81076.1| P protein [Flaveria pringlei]
          Length = 1037

 Score = 1051 bits (2717), Expect(2) = 0.0
 Identities = 512/758 (67%), Positives = 610/758 (79%), Gaps = 3/758 (0%)
 Frame = +1

Query: 223  SGFAASGIRSISVAALQPSDDFKPRHNSGTPAEIDSMVKATGFGSLDALIDATVPKAIVR 402
            +GF  S +R+ISV AL+PSD F  RHNS TP E   M +  GF +LD+LIDATVPK+I R
Sbjct: 58   NGFG-SQVRTISVEALKPSDTFPRRHNSATPEEQTKMAEFVGFPNLDSLIDATVPKSI-R 115

Query: 403  KDGMNLGKYHEGMTESQFLEYFKAMASKNKVYKSYIGMGYYGTHVPNVILRNVLENPGWY 582
             D M   K+ EG+TESQ + + + +ASKNK++KS+IGMGYY T VP VILRN++ENPGWY
Sbjct: 116  LDSMKYSKFDEGLTESQMIAHMQDLASKNKIFKSFIGMGYYNTSVPTVILRNIMENPGWY 175

Query: 583  TQYTPYQAEIAQGRLESLLNFQTMICDLTGMAISNASLLDEATAAAEAMTMCSAIARGKK 762
            TQYTPYQAEIAQGRLESLLNFQTM+ DLTG+ +SNASLLDE TAAAEAM MC+ I +GKK
Sbjct: 176  TQYTPYQAEIAQGRLESLLNFQTMVTDLTGLPMSNASLLDEGTAAAEAMAMCNNIQKGKK 235

Query: 763  PKFLVSSKCHPQTIAVCQTRAEGLGLEAVVVDEDKMAYAK-DVCGVLLQYPATDGSISDY 939
              F+++S CHPQTI +C+TRA+G  L+ V  D     Y+  DVCGVL+QYP T+G + DY
Sbjct: 236  KTFIIASNCHPQTIDICKTRADGFDLKVVTSDLKDFDYSSGDVCGVLVQYPGTEGELLDY 295

Query: 940  KALVAKAHAANVKVCVATDLLALTMLAPPGEWGADIVIGSAQRFGVPMGYGGPHAAFLAC 1119
               +  AHA  VKV +A+DLLALT+L PPGE GADIV+GSAQRFGVPMGYGGPHAAFLA 
Sbjct: 296  SEFIKNAHANGVKVVMASDLLALTILKPPGELGADIVVGSAQRFGVPMGYGGPHAAFLAT 355

Query: 1120 HDEFKRLMPGRIIGMSIDAQGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAALYA 1299
              E+KR+MPGRIIG+S+D+ GKPALRMAMQTREQHIRRDKATSNICTAQALLANMAA++ 
Sbjct: 356  SQEYKRMMPGRIIGVSVDSSGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAAMFG 415

Query: 1300 VYHGPEGLKTIAHRVNGLASVFAAGAAKLGHT-VPSAPFFDTVSVTVKDGDADKYVALAL 1476
            VYHGPEGLKTIA RV+GLA  FAAG  KLG   V   PFFDTV VT  D  A      A 
Sbjct: 416  VYHGPEGLKTIAKRVHGLAGTFAAGLKKLGTVQVQDLPFFDTVKVTCVDSKA--IAEEAY 473

Query: 1477 NEKINIRKLSKNTISLAFDETSSVADVDALLRVLNCGRDAPFTAASLAPAVEGGV-GGFA 1653
              K+N+R + KNTI++AFDET ++ DVD L +V   G+   FTAAS+AP V+  +  G  
Sbjct: 474  KHKMNLRIVDKNTITVAFDETITIEDVDTLFKVFALGKPVTFTAASIAPEVQDAIPSGLV 533

Query: 1654 RKSTFLQQPIFNTYHNEHDMLRYLKRLENKDLSLVHSMIPLGSCTMKLNATAEMMPITWP 1833
            R++ +L  PIFN YH EH++LRY+ +L++KDLSL HSMIPLGSCTMKLNAT EMMP+TWP
Sbjct: 534  RETPYLTHPIFNMYHTEHELLRYISKLQSKDLSLCHSMIPLGSCTMKLNATTEMMPVTWP 593

Query: 1834 ELAALHPFVPVDQAEGYAEMFRDLSAQLCSITGFDAMSLQPNSGASGEYAGLMAIRAFHL 2013
              A +HPF P +QA+GY EMF++L   LC+ITGFD+ SLQPN+GA+GEYAGLM IRA+H+
Sbjct: 594  AFADIHPFAPTEQAQGYQEMFKNLGDLLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHM 653

Query: 2014 SRNEGHRNVCIIPVSAHGTNPASAVMAGMKIVTVSTDSQGNVNIPELRAKAEEHSKNLAA 2193
            +R + HRNVCIIPVSAHGTNPASA M GMKI+TV TDS+GN+NI ELR  AE + +NL+A
Sbjct: 654  ARGDHHRNVCIIPVSAHGTNPASAAMCGMKIITVGTDSKGNINIEELRKAAEANKENLSA 713

Query: 2194 LMITYPSTHGVYEDGVDEICRIIHQHGGQVYMDGANMNAQVGLTAPGLIGADVCHLNLHK 2373
            LM+TYPSTHGVYE+G+DEIC+IIH +GGQVYMDGANMNAQVGLT+PG IGADVCHLNLHK
Sbjct: 714  LMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTSPGWIGADVCHLNLHK 773

Query: 2374 TFCIPHGGGGPGMGPIGVKAHLAPFLPTHPVVPTGALP 2487
            TFCIPHGGGGPGMGPIGVK HLAP+LP+HPVV TG +P
Sbjct: 774  TFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVATGGIP 811

 Score = 51.6 bits (122), Expect(2) = 0.0
 Identities = 23/33 (69%), Positives = 28/33 (84%)
 Frame = +2

Query: 2495 PSTPKPFGTMAAAPFGSSLILPISYAYISMMGS 2593
            P   +P GT+AAAP+GS+LILPISY YI+MMGS
Sbjct: 813  PEQSQPLGTIAAAPWGSALILPISYTYIAMMGS 845



EST assemble image


clone accession position
1 LCL002a11_r AV626079 1 336
2 MXL061c09_r BP096592 5 403
3 LCL033h09_r AV627922 6 220
4 HCL075g06_r AV643773 7 473
5 LCL014d07_r AV626726 9 308
6 MXL100b02_r BP098846 9 384
7 MXL029d01_r BP094776 11 407
8 MXL097b08_r BP098668 12 417
9 LCL018g04_r AV626954 12 515
10 LCL007c04_r AV626337 12 117
11 LCL050a03_r AV628986 16 269
12 LCL072f08_r AV630081 16 541
13 CL14h12_r AV393872 18 492
14 MXL003a08_r BP093075 21 244
15 MXL039d12_r BP095291 21 399
16 LCL061h09_r AV629609 22 469
17 LCL060g03_r AV629548 22 390
18 MXL016e09_r BP093982 22 512
19 LCL056h08_r AV629342 22 568
20 LCL033g01_r AV627907 22 427
21 MXL089a08_r BP098190 26 189
22 HCL031h05_r AV641339 26 437
23 LCL068c08_r AV629884 27 498
24 LCL013f04_r AV626683 28 487
25 MXL061b01_r BP096580 31 476
26 LCL047b08_r AV628791 32 474
27 CL56g11_r AV396131 34 575
28 MXL093f11_r BP098463 34 473
29 MXL086e02_r BP098072 35 386
30 MXL093b11_r BP098432 36 463
31 MXL058h09_r BP096450 36 399
32 LCL016c07_r AV626836 37 288
33 HCL090c03_r AV644540 44 405
34 MXL005a06_r BP093210 44 544
35 LCL084f12_r AV630815 44 515
36 LCL096e07_r AV631586 44 334
37 HCL009b10_r AV640035 44 320
38 HCL098e07_r AV645124 44 435
39 CL51c10_r AV395924 45 598
40 MXL076a12_r BP097460 52 340
41 MXL052a08_r BP096067 58 468
42 LCL037d12_r AV628147 116 339
43 LCL015d09_r AV626788 126 641
44 MXL084g07_r BP097988 139 504
45 LCL096f03_r AV631594 151 665
46 LCL033d02_r AV627884 160 640
47 MXL064h06_r BP096786 168 574
48 LCL086h05_r AV630960 177 622
49 CL08c11_r AV393545 180 628
50 MXL046h05_r BP095752 192 667
51 HCL014b01_r AV640314 258 664
52 LCL049h11_r AV628982 275 599
53 MXL041a02_r BP095385 275 739
54 HCL040a02_r AV641771 281 776
55 LCL033b11_r AV627874 294 607
56 LCL066c04_r AV629789 302 793
57 MXL048g01_r BP095880 302 695
58 MXL033g06_r BP094980 319 580
59 CL32e07_r AV394866 343 870
60 LCL030a11_r AV627653 356 592
61 MXL057e03_r BP096360 359 846
62 LCL022b04_r AV627167 364 780
63 MXL018a01_r BP094087 372 626
64 MXL053h12_r BP096169 379 781
65 LCL067c11_r AV629841 384 885
66 LCL053e10_r AV629168 385 860
67 LCL084b12_r AV630780 386 865
68 MXL076f03_r BP097489 393 829
69 MXL073c11_r BP097303 393 773
70 MXL020c09_r BP094264 448 897
71 HCL042e01_r AV641921 461 918
72 MXL008a11_r BP093414 466 676
73 MXL003b06_r BP093082 486 865
74 LCL020b05_r AV627033 500 919
75 LCL012c10_r AV626614 515 948
76 CL69a10_r AV396801 529 1040
77 LCL010h01_r AV626536 564 961
78 LCL049a04_r AV628919 564 840
79 LCL015a05_r AV626761 567 954
80 LCL061h07_r AV629607 578 1080
81 LCL087e04_r AV631003 620 1077
82 LCL084d04_r AV630791 638 1144
83 MXL048g12_r BP095888 660 1043
84 MXL087g12_r BP098133 672 1171
85 LCL076e05_r AV630275 683 1017
86 LCL002e09_r AV626114 752 1094
87 LCL011g04_r AV626578 774 979
88 LCL065c06_r AV629753 820 1231
89 CL55d06_r AV396054 882 1443
90 HCL029f01_r AV641196 910 1410
91 LCL004a06_r AV626192 1019 1214
92 MXL099c01_r BP098791 1131 1497
93 MXL054f12_r BP096214 1240 1628
94 LCL077g09_r AV630360 1352 1638
95 LCL007h05_r AV626364 1446 1731
96 MX203f02_r BP089243 1471 1827
97 LCL085g10_r AV630889 1506 1643
98 LC013c08_r AV619796 1671 2294
99 LCL053c02_r AV629154 1713 2218
100 LCL042b10_r AV628458 2128 2599
101 LCL001a04_r AV626009 2154 2535




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research