KCC000171A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000171A_C01 KCC000171A_c01
gcggcgtagtcgtgttctttcgtgtcctatcaaggctccaagtatccctatcgtgttttt
atcatcacagatggtacctaGCTCTGGCCTTTAATGGCCGGGTGTGGTCTGTCTGTGACT
TATTTCAAGGCGGGAGTTGCTGCAAATGGGTTGCGCAACGTGGACACGCGTGAGCAAGCT
ACAAGACGGTATTTTGGGAGATGGGAAGGTGGTGCTGGGCCCAAGGCCGGCGTCTTGGCT
AAGTACAGACTATTAGCAGTTGGCCTGAGGTAGGATGTGGGCAAGACAGACGGAATGGAT
TCAATCAATGTCGCGTACCCGGTCGGAAGCTGAGGCTGCTGGTGCAGGATCCCGCACGCA
CATGGCGGCGGGATGCATCTGCGGGCGGAAGTTTCCTGAGCCGCCGAACAGGGGCGTACG
CAAATGATGCTGGTGGATTGTCCGTACTTGTATGAGGGCGTGATGGTGGGCAGGTGCCAG
GATTAAAGGGCTGCACCTATCACGTCCAGTGTTACATGGGAGAAAGTGTACTGATACTTC
TTCGCCCACATGTGCCTCTGGGCGGTGTGAGTGCTGGCTATTGGGCACCACGCCCGGATT
GGTGTGGGGCATGGCGGCACGTCAAGGCGGTGGGCAGGTGTTACTGGCTGGACTGGTGTG
GACCCGCGCATTGGCGCCTATCCCAGGCCTGCCGTGTTCCGAGGCGTAGCCTCCCTTGTG
AGAGCTAGGGCGGTGGCCCAACGGTTGGAACAATGGTCGGTTGACAGGCTGACACTACAG
TGGAAGACACACTTTGCCTCATTTAGCTTGCTGATACGGTATTATCTGTACTGACTGAAT
GGAGTAGACATTCTGAGCGGGAGTGTGCGGAGTTTGGATTTACACTATGCACATGGCGGC
GATGCGGCAACCATAACCACGGCTTTGCCAGCCGGCCGGCCGGGCACCTACCCAACACTT
CCGCATGCACGCATGCGAGCACGAGGCGCCCCATTGGCGCAGGGTTGCTCGCGTGTGGTG
ACACTGTACGTGCGTGCGGGAGTGGGGATGCTCGGGTTTGCTGAGAGAGTTCAGGCCCTA
CAGTGCAGGCGGTGGCAGCTGGTCGATTGGATCGGGCAATCCTTTTGTTCCGCAGCCCCG
GGATACGTTTGCTTCCCGGACGTGCCGTCTGCATGCATGGTAAGGATATGCCTGGGGTAT
GCAGGCTCCTCAATCACTTGCGAGTAGTTTTGTCCGTTGAACGCCTTGGCAGAC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000171A_C01 KCC000171A_c01
         (1254 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAL84247.1|AF458047_1 type III effector HopPmaI [Pseudomonas ...    33  0.43
ref|NP_296138.1| conserved hypothetical protein [Deinococcus rad...    30  0.55
gb|AAN11194.1| Hypothetical protein [Oryza sativa (japonica cult...    29  0.58
gb|AAO61195.1|AF411814_1 Gag polyprotein [amphotropic murine leu...    37  0.73
gb|AAO61197.1|AF411814_3 Gag-Pro-Pol polyprotein [amphotropic mu...    37  0.73

>gb|AAL84247.1|AF458047_1 type III effector HopPmaI [Pseudomonas syringae pv. maculicola]
          Length = 432

 Score = 33.1 bits (74), Expect(2) = 0.43
 Identities = 22/59 (37%), Positives = 28/59 (47%)
 Frame = -1

Query: 732 RPSSHKGGYASEHGRPGIGANARVHTSPASNTCPPP*RAAMPHTNPGVVPNSQHSHRPE 556
           RPSS + G A +  RP     +R    P +N+ PPP RA  P    G    +Q   RPE
Sbjct: 227 RPSSGRPGGAQQQARPETPPRSR----PQTNSAPPPPRAE-PRPASGRPGGAQQQARPE 280

 Score = 23.5 bits (49), Expect(2) = 0.43
 Identities = 11/23 (47%), Positives = 12/23 (51%)
 Frame = -3

Query: 493 QPFNPGTCPPSRPHTSTDNPPAS 425
           Q   P T P SRP T+   PP S
Sbjct: 312 QQARPETPPRSRPQTNNAPPPRS 334

>ref|NP_296138.1| conserved hypothetical protein [Deinococcus radiodurans]
          Length = 579

 Score = 30.0 bits (66), Expect(2) = 0.55
 Identities = 16/45 (35%), Positives = 21/45 (46%)
 Frame = -3

Query: 481 PGTCPPSRPHTSTDNPPASFAYAPVRRLRKLPPADASRRHVRAGS 347
           P  CPP +P   T NPP           R+  P   +RR+VR G+
Sbjct: 497 PRLCPP-QPRPRTANPPGGARSRGTGPAREKAPGRRARRYVRRGA 540

 Score = 26.2 bits (56), Expect(2) = 0.55
 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 4/47 (8%)
 Frame = -1

Query: 720 HKGGYASEHGRPGIGANARVHTS----PASNTCPPP*RAAMPHTNPG 592
           H+GG     GRPG G   R   +    P       P R A PH   G
Sbjct: 447 HRGGGRGLRGRPGRGRRERRRAARPRQPQPGRAADPDRRAAPHPARG 493

>gb|AAN11194.1| Hypothetical protein [Oryza sativa (japonica cultivar-group)]
           gi|31430037|gb|AAP52008.1| hypothetical protein [Oryza
           sativa (japonica cultivar-group)]
          Length = 293

 Score = 28.9 bits (63), Expect(2) = 0.58
 Identities = 25/102 (24%), Positives = 37/102 (35%), Gaps = 2/102 (1%)
 Frame = -3

Query: 634 PTALTCRHAPHQSGRGAQ*PALTPPRGTCGRRSISTLSPM*HWT**VQPFNPGTCPPSRP 455
           P + T    P   G     P   PP  + G    S  +P   ++    P  P   PPS  
Sbjct: 143 PASGTSPSTPGSGGYSPSTPCSAPPLPSSGT---SPTTPGGGYS----PSTPCNAPPSPS 195

Query: 454 HTSTDNPPASFAYAPVRRLRKLPPADAS--RRHVRAGSCTSS 335
             ++   P    Y P   +  +PP+ +S        G C+SS
Sbjct: 196 SDTSPTTPGGGNYPPAPTIGNVPPSPSSGTSPSTPGGGCSSS 237

 Score = 27.3 bits (59), Expect(2) = 0.58
 Identities = 31/120 (25%), Positives = 45/120 (36%), Gaps = 5/120 (4%)
 Frame = -1

Query: 975 HACMRKCWVGARPAGWQSRGYGCRIAAMCIV*IQTPHT-----PAQNVYSIQSVQIIPYQ 811
           HA +   W  +   GW    +  R AA  +    + HT     PA  V+  ++   +   
Sbjct: 37  HAALAVQWQLSHYTGWMLHSHAVRHAARAVEWHLSDHTGWKLLPAHAVHWRRATLAVQRH 96

Query: 810 QAK*GKVCLPL*CQPVNRPLFQPLGHRPSSHKGGYASEHGRPGIGANARVHTSPASNTCP 631
            +      LP    P + P     G  P++  GGY      P +G    V  SPAS T P
Sbjct: 97  LSDHTGRRLP--STPCDTPPLPSSGTSPTTPGGGYYPP--TPSVG---DVPPSPASGTSP 149

>gb|AAO61195.1|AF411814_1 Gag polyprotein [amphotropic murine leukemia virus]
          Length = 536

 Score = 37.0 bits (84), Expect = 0.73
 Identities = 26/61 (42%), Positives = 31/61 (50%), Gaps = 2/61 (3%)
 Frame = -2

Query: 371 PPPCACGILHQQPQLPTGYATLIESIPSVLPTSYLR-PTANSLYLAKTPALGPAP-PSHL 198
           PPP     +H +P LP        S PS+LP   L  P  +SLY A TP+LG  P P  L
Sbjct: 93  PPPWVKPFVHPKPPLPP-------SAPSLLPEPPLSTPPRSSLYPALTPSLGAKPKPQVL 145

Query: 197 P 195
           P
Sbjct: 146 P 146

>gb|AAO61197.1|AF411814_3 Gag-Pro-Pol polyprotein [amphotropic murine leukemia virus]
          Length = 1736

 Score = 37.0 bits (84), Expect = 0.73
 Identities = 26/61 (42%), Positives = 31/61 (50%), Gaps = 2/61 (3%)
 Frame = -2

Query: 371 PPPCACGILHQQPQLPTGYATLIESIPSVLPTSYLR-PTANSLYLAKTPALGPAP-PSHL 198
           PPP     +H +P LP        S PS+LP   L  P  +SLY A TP+LG  P P  L
Sbjct: 93  PPPWVKPFVHPKPPLPP-------SAPSLLPEPPLSTPPRSSLYPALTPSLGAKPKPQVL 145

Query: 197 P 195
           P
Sbjct: 146 P 146



EST assemble image


clone accession position
1 HCL077c02_r AV643854 1 472
2 CM017g07_r AV388198 334 949
3 CM065a07_r AV391149 459 1046
4 CL08c10_r AV393530 758 1254




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research