KCC000170A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000170A_C01 KCC000170A_c01
catacgaTGTAACATGTCGAACTTGCCAACACTTCATTGAAGAACTGGGCGTTGCGGCGA
GTTTACATTCACAAGTTTGCCAGCAAGCTCCCAGTATTTTCAATTGCATCATAAGCACGC
CTGGTTTCCCTGGAGTTGTGTGTTAGAATTCAAGCGCGCGTCGCTTCGGCGGCAAATTCG
CTAGCGAGGGCTGTTTTTGCCACCTCTCGGAAATTCGTGACGCACCGAAGTAGAGCATCA
CTATCAGTGGGGTGCCAAGCTTTCTTCCTGCTGCCTGACCTCACGGTCGGAGTCCGCAAT
GGACTCCGTAGTGGGTCCCTGGCCGCTGCTGTTGTCGCCACAGTATGATAACTATGGCGC
CTCAGCATCTGTCTCCCCTGTGGGCGGGCCCGTGCTGGTTGGGACGAAAAGGCAGCATGG
CCCACCAGCGCACTTGCCTTGCGCGGACAGATACCGCAGCGCCCGACCGCTTGCGCGGCC
CCGATTAAGCGACGTGACCTCACAATGCGATGCCGCAGCTGGCACGGAGTCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000170A_C01 KCC000170A_c01
         (532 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAB92810.1| P0551A11.2 [Oryza sativa (japonica cultivar-grou...    34  1.0
ref|NP_294689.1| GMC oxidoreductase [Deinococcus radiodurans] gi...    33  1.8
ref|XP_227060.2| similar to ENSANGP00000007226 [Rattus norvegicus]     33  2.3
ref|XP_192674.1| similar to netrin 4; beta-netrin [Mus musculus]       32  3.9
ref|NP_067295.1| netrin 4; beta-netrin [Mus musculus] gi|9652103...    32  3.9

>dbj|BAB92810.1| P0551A11.2 [Oryza sativa (japonica cultivar-group)]
           gi|21328104|dbj|BAC00685.1| OJ1116_C07.2 [Oryza sativa
           (japonica cultivar-group)]
          Length = 285

 Score = 34.3 bits (77), Expect = 1.0
 Identities = 20/68 (29%), Positives = 32/68 (46%), Gaps = 2/68 (2%)
 Frame = -3

Query: 419 HAAFSSQPARARPQGRQMLRRHSYHTVATTAAARDPLRSP--LRTPTVRSGSRKKAWHPT 246
           H   +  PAR  P        + +H + + AAAR   + P  +     RSG R  ++HP 
Sbjct: 117 HTRRAPAPARVGPVPPPHRTSYHHHRLDSCAAARRAYKRPCTVNETGARSGGRGVSFHPE 176

Query: 245 DSDALLRC 222
           +++A  RC
Sbjct: 177 EAEAAWRC 184

>ref|NP_294689.1| GMC oxidoreductase [Deinococcus radiodurans] gi|7471986|pir||C75453
           GMC oxidoreductase - Deinococcus radiodurans (strain R1)
           gi|6458692|gb|AAF10542.1|AE001949_1 GMC oxidoreductase
           [Deinococcus radiodurans]
          Length = 529

 Score = 33.5 bits (75), Expect = 1.8
 Identities = 33/102 (32%), Positives = 41/102 (39%), Gaps = 7/102 (6%)
 Frame = -3

Query: 410 FSSQPARARPQGRQMLRRHSYHTVATTAAARDPLRSPLRTPTVRSGSRKKAWHPTDSDAL 231
           F+  P   +P  R  +R           A+ DPL  PL  P   S SR       D D L
Sbjct: 373 FTLLPTLLQPHSRGQIR----------LASADPLARPLIEPNYLSDSR-------DLDVL 415

Query: 230 LRCVTNFREVAKTALASEF-------AAEATRA*ILTHNSRE 126
           LR +   REVA TA  + +        A AT    LT + RE
Sbjct: 416 LRGIELAREVADTAALTSYRRAEFLPGAGATDRAALTEHVRE 457

>ref|XP_227060.2| similar to ENSANGP00000007226 [Rattus norvegicus]
          Length = 5046

 Score = 33.1 bits (74), Expect = 2.3
 Identities = 17/42 (40%), Positives = 21/42 (49%)
 Frame = +3

Query: 12   TCRTCQHFIEELGVAASLHSQVCQQAPSIFNCIISTPGFPGV 137
            T R C+  I E   +   H  VCQ  P  FNC+  T G+ GV
Sbjct: 3995 TGRACERDINECLPSPCKHGAVCQNFPGGFNCVCKT-GYTGV 4035

>ref|XP_192674.1| similar to netrin 4; beta-netrin [Mus musculus]
          Length = 628

 Score = 32.3 bits (72), Expect = 3.9
 Identities = 17/44 (38%), Positives = 22/44 (49%), Gaps = 3/44 (6%)
 Frame = +3

Query: 315 VPGRCCCRHSMITMAPQHLSPLWAGPCWL---GRKGSMAHQRTC 437
           V GRC C+H+      QH +PL+    W    GR G+    RTC
Sbjct: 289 VHGRCMCKHNTAGSHCQHCAPLYNDRPWEAADGRTGAPNECRTC 332

>ref|NP_067295.1| netrin 4; beta-netrin [Mus musculus]
           gi|9652103|gb|AAF91404.1|AF268066_1 netrin 4 [Mus
           musculus] gi|11120055|gb|AAG30823.1|AF281278_1 beta
           netrin [Mus musculus]
          Length = 628

 Score = 32.3 bits (72), Expect = 3.9
 Identities = 17/44 (38%), Positives = 22/44 (49%), Gaps = 3/44 (6%)
 Frame = +3

Query: 315 VPGRCCCRHSMITMAPQHLSPLWAGPCWL---GRKGSMAHQRTC 437
           V GRC C+H+      QH +PL+    W    GR G+    RTC
Sbjct: 289 VHGRCMCKHNTAGSHCQHCAPLYNDRPWEAADGRTGAPNECRTC 332



EST assemble image


clone accession position
1 LCL044a01_r AV628574 1 505
2 HCL091g09_r AV644655 8 512
3 LCL053b03_r AV629151 8 531
4 MXL064c08_r BP096753 12 405
5 HCL062g07_r AV643044 16 512
6 CL08c09_r AV393523 26 532
7 LCL079e07_r AV630482 35 178
8 MXL014g12_r BP093860 45 297




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research