KCC000169A_c06
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000169A_C06 KCC000169A_c06
GGCACCATGTCGCACAGGAAGTTCGAACACCCTCGTAGCTGTGCTCGCTGGGCTTCAGCC
CCCGCAAGCGCTGCCGCCGCGGCAAGGGCAAGGTGAAGTCGTTCCCCCGTGGACGATGCC
TCCAAGCCTGTGCACCTGACTGCCTTCATGGGCTAGCAAGGCCGGCATGACTCACATCGT
CCGCGATGTGGAGAAGCCTGGCTCCAAGGCTGCACAAGAAGTGAGACCTGCGAGCCGGTC
ACCATCATCGAGTGCCCTCCCATGGTCGTGGTCTGGTGCGGTCGGCTACGTGAAGACCCC
CCGCGGTCTGCGCTCGCTGAACACCGTCTGGGCTGAGCACCTGAGCCGAGGGAGGTGAAG
CGCAGGTTCTACAAGAACTGGTACAAGTCCAAGAAGAAGGGCTTCACCAATGTACGCCAA
GAAGTACAGCGACGGCAAGAAGGCCATCGAGGCCGAGCTGGCCGCCCTGAAGAAGCACTG
CTGCGGTGATCCGTGGTGCTGGCGCACACCCCAGGTCAAGAAGCTGGGCTTTGGCGTGAA
GAAGGCCCACCTGATGGAGGTCCAGGTGAACGGCGGCACTGTGGCGCAGAAGGTCGACTT
CGCCTACAGCATGTTCGAGAAGCAGTGTGTCTGTGGACGCCGTGTTCCAGCCCAACGAGA
TGATCGACACCATCGCCATCACCAAGGGTCACGGAGTCCAGGGTGTCGTGCAGCGCTGGG
GTGTGACCCGCCTGCCCCGCAAGACTCACCGCGGTCTCCGCAAGGTGGCTTGCATTGGCG
CGTGGCACCCTGCCCGCGTGAAGTGGACTGTGGCCCGCGCCGGTCAGCAGGGCTTCCACC
ACCGCACTGAGATCAACAAGAAGGTGTACAAGATCGGCAAGAAGGGCGACGCCAGCCACC
TGGCCACCACGGAGTTCGATGTGACCAAGAAGGAGATCACCCCCATGGGTGGCTTCCCCC
ACTACGGTGTGGTCAGCGAGGACTACCTGATGATCAAGGGCTGCGTGCCGGGCACCAAGA
AGCGCGCCATCACCCTGCGCCGCTCGCTGCTGCCCCAGACCAGCCGCAACGCGCTGGAGG
AGGTCAAGCTCAAGTTCATCGACACTGCCTCCAAGTTTGGCCACGGCCGCTTCCAGACCA
CCGAGGAGAAGCTCAAGACCTTCGGCCGCACCAAGGCCTAAGCGCTTGCATGGACTGCTT
CCTCGTGAACAATCTAGCGGTTGCTGCAACCCCCTAGCTGGCGTGCTCAGCCTGGGGCGC
AGCCTGGCAGGGCTCATTGTGCGTACGGTGGCGGACTAAAGGAAGGATGCGGGGAAGCCC
CTTCGTGACTTTTGTTAATTGCCCTACGTGTTAACTGCGGCCTCGCTACTTTGGTGGCAA
TGGGTTATCAAGAGGAGGACACACTTTTATGACCACTTGCCAcc


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000169A_C06 KCC000169A_c06
         (1424 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P35684|RL3_ORYSA 60S RIBOSOMAL PROTEIN L3 gi|481228|pir||S383...   298  e-113
gb|AAQ21396.1| ribosomal protein L3 [Triticum aestivum] gi|33526...   295  e-113
gb|AAQ62075.1| ribosomal protein L3 [Triticum aestivum] gi|34105...   294  e-112
gb|AAQ21397.1| ribosomal protein L3 [Triticum aestivum] gi|34105...   294  e-112
ref|NP_175009.1| 60S ribosomal protein L3 (RPL3A) [Arabidopsis t...   282  e-112

>sp|P35684|RL3_ORYSA 60S RIBOSOMAL PROTEIN L3 gi|481228|pir||S38359 ribosomal protein
            L3.e, cytosolic - rice gi|303853|dbj|BAA02155.1|
            ribosomal protein L3 [Oryza sativa (japonica
            cultivar-group)]
          Length = 389

 Score =  298 bits (762), Expect(3) = e-113
 Identities = 142/184 (77%), Positives = 158/184 (85%)
 Frame = +3

Query: 627  VSVDAVFQPNEMIDTIAITKGHGVQGVVQRWGVTRLPRKTHRGLRKVACIGAWHPARVKW 806
            + VDAVFQ +EMID I +TKG G +GVV RWGVTRLPRKTHRGLRKVACIGAWHPARV +
Sbjct: 206  IPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSY 265

Query: 807  TVARAGQQGFHHRTEINKKVYKIGKKGDASHLATTEFDVTKKEITPMGGFPHYGVVSEDY 986
            TVARAGQ G+HHRTE+NKKVYKIGK G  SH A TEFD T+K+ITPMGGFPHYGVV  DY
Sbjct: 266  TVARAGQNGYHHRTEMNKKVYKIGKSGQESHAACTEFDRTEKDITPMGGFPHYGVVKGDY 325

Query: 987  LMIKGCVPGTKKRAITLRRSLLPQTSRNALEEVKLKFIDTASKFGHGRFQTTEEKLKTFG 1166
            LMIKGC  G KKR +TLR+SLL QTSR ALEE+KLKFIDT+SKFGHGRFQTT+EK + FG
Sbjct: 326  LMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTDEKQRFFG 385

Query: 1167 RTKA 1178
            + KA
Sbjct: 386  KLKA 389

 Score =  119 bits (297), Expect(3) = e-113
 Identities = 72/158 (45%), Positives = 90/158 (56%), Gaps = 2/158 (1%)
 Frame = +2

Query: 158 KAGMTHIVRDVEKPGSKAAQEVRPASRSPSSSALPWSWSGAVGYVKTPRGLRSLNTVWAE 337
           KAGMTHIVR+VEKPGSK  ++             P    G V YVKTPRGLRSLN+VWA+
Sbjct: 50  KAGMTHIVREVEKPGSKLHKK-ETCEAVTIIETPPLVIVGLVAYVKTPRGLRSLNSVWAQ 108

Query: 338 HLSRGR*SAGSTRTGTSPRRRASPMYAKKYSD--GKKAIEAELAALKKHCCGDPWCWRTP 511
           HLS         +     +++A   YA KY    GKK I+ +L  +KK+         T 
Sbjct: 109 HLSE-EVRRRFYKNWCKSKKKAFTKYALKYDSDAGKKEIQMQLEKMKKYASIVRVIAHTQ 167

Query: 512 QVKKLGFGVKKAHLMEVQVNGGTVAQKVDFAYSMFEKQ 625
             K  G   KKAHLME+Q+NGGT+A KVD+ Y  FEK+
Sbjct: 168 IRKMKGLKQKKAHLMEIQINGGTIADKVDYGYKFFEKE 205

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 59/139 (42%), Positives = 72/139 (51%), Gaps = 5/139 (3%)
 Frame = +1

Query: 7   MSHRKFEHPRSCARWASAPASAAAAARAR*SRSPVDDASKPVHLTAFMG*QGRHDSHRPR 186
           MSHRKFEHPR        P   ++  R +    P DD SKP HLT+F+G +    +H  R
Sbjct: 1   MSHRKFEHPRH-GSLGFLPRKRSSRHRGKVKSFPKDDVSKPCHLTSFVGYKAGM-THIVR 58

Query: 187 CGEAWLQGCTRSETCEPVTIIECPPMVVVWCGRLREDPP-----RSALAEHRLG*APEPR 351
             E       + ETCE VTIIE PP+V+V      + P       S  A+H         
Sbjct: 59  EVEKPGSKLHKKETCEAVTIIETPPLVIVGLVAYVKTPRGLRSLNSVWAQHL------SE 112

Query: 352 EVKRRFYKNWYKSKKKGFT 408
           EV+RRFYKNW KSKKK FT
Sbjct: 113 EVRRRFYKNWCKSKKKAFT 131

 Score = 37.4 bits (85), Expect(3) = e-113
 Identities = 17/29 (58%), Positives = 20/29 (68%)
 Frame = +3

Query: 45  SLGFSPRKRCRRGKGKVKSFPRGRCLQAC 131
           SLGF PRKR  R +GKVKSFP+    + C
Sbjct: 13  SLGFLPRKRSSRHRGKVKSFPKDDVSKPC 41

>gb|AAQ21396.1| ribosomal protein L3 [Triticum aestivum] gi|33526922|gb|AAQ21399.1|
            ribosomal protein L3 [Triticum aestivum]
          Length = 389

 Score =  295 bits (755), Expect(3) = e-113
 Identities = 140/184 (76%), Positives = 158/184 (85%)
 Frame = +3

Query: 627  VSVDAVFQPNEMIDTIAITKGHGVQGVVQRWGVTRLPRKTHRGLRKVACIGAWHPARVKW 806
            V V+AVFQ +EM+D I +TKG G +GVV RWGVTRLPRKTHRGLRKVACIGAWHPARV +
Sbjct: 206  VPVEAVFQKDEMVDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSY 265

Query: 807  TVARAGQQGFHHRTEINKKVYKIGKKGDASHLATTEFDVTKKEITPMGGFPHYGVVSEDY 986
            TVARAGQ G+HHRTE+NKK+YK+GK G  SH A TEFD T+K+ITPMGGFPHYGVV  DY
Sbjct: 266  TVARAGQNGYHHRTEMNKKIYKMGKSGQESHEACTEFDRTEKDITPMGGFPHYGVVKGDY 325

Query: 987  LMIKGCVPGTKKRAITLRRSLLPQTSRNALEEVKLKFIDTASKFGHGRFQTTEEKLKTFG 1166
            LMIKGC  G KKR +TLR+SLL QTSR ALEE+KLKFIDT+SKFGHGRFQTT+EK K +G
Sbjct: 326  LMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTDEKQKFYG 385

Query: 1167 RTKA 1178
            R KA
Sbjct: 386  RLKA 389

 Score =  118 bits (295), Expect(3) = e-113
 Identities = 72/158 (45%), Positives = 90/158 (56%), Gaps = 2/158 (1%)
 Frame = +2

Query: 158 KAGMTHIVRDVEKPGSKAAQEVRPASRSPSSSALPWSWSGAVGYVKTPRGLRSLNTVWAE 337
           KAGMTHIVR+VEKPGSK  ++             P    G V YVKTPRGLR+LN+VWA+
Sbjct: 50  KAGMTHIVREVEKPGSKLHKK-ETCEAVTIIETPPLVIVGLVAYVKTPRGLRTLNSVWAQ 108

Query: 338 HLSRGR*SAGSTRTGTSPRRRASPMYAKKYSD--GKKAIEAELAALKKHCCGDPWCWRTP 511
           HLS         +     +++A   YA KY    GKK I+ +L  +KK+         T 
Sbjct: 109 HLSEDV-RRRFYKNWCKSKKKAFTKYALKYDSDAGKKEIQLQLEKMKKYATIVRVIAHTQ 167

Query: 512 QVKKLGFGVKKAHLMEVQVNGGTVAQKVDFAYSMFEKQ 625
             K  G   KKAHLME+QVNGGT+A KVD+ Y  FEK+
Sbjct: 168 IRKMKGLKQKKAHLMEIQVNGGTIADKVDYGYKFFEKE 205

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 58/139 (41%), Positives = 70/139 (49%), Gaps = 5/139 (3%)
 Frame = +1

Query: 7   MSHRKFEHPRSCARWASAPASAAAAARAR*SRSPVDDASKPVHLTAFMG*QGRHDSHRPR 186
           MSHRKFEHPR        P    +  R +    P DD  KP HLTAF+G +    +H  R
Sbjct: 1   MSHRKFEHPRH-GSLGFLPRKRCSRHRGKVKSFPKDDQQKPCHLTAFLGYKAGM-THIVR 58

Query: 187 CGEAWLQGCTRSETCEPVTIIECPPMVVVWCGRLREDPP-----RSALAEHRLG*APEPR 351
             E       + ETCE VTIIE PP+V+V      + P       S  A+H         
Sbjct: 59  EVEKPGSKLHKKETCEAVTIIETPPLVIVGLVAYVKTPRGLRTLNSVWAQHL------SE 112

Query: 352 EVKRRFYKNWYKSKKKGFT 408
           +V+RRFYKNW KSKKK FT
Sbjct: 113 DVRRRFYKNWCKSKKKAFT 131

 Score = 40.4 bits (93), Expect(3) = e-113
 Identities = 18/29 (62%), Positives = 21/29 (72%)
 Frame = +3

Query: 45  SLGFSPRKRCRRGKGKVKSFPRGRCLQAC 131
           SLGF PRKRC R +GKVKSFP+    + C
Sbjct: 13  SLGFLPRKRCSRHRGKVKSFPKDDQQKPC 41

>gb|AAQ62075.1| ribosomal protein L3 [Triticum aestivum] gi|34105770|gb|AAQ62076.1|
            ribosomal protein L3 [Triticum aestivum]
          Length = 389

 Score =  294 bits (753), Expect(3) = e-112
 Identities = 139/184 (75%), Positives = 159/184 (85%)
 Frame = +3

Query: 627  VSVDAVFQPNEMIDTIAITKGHGVQGVVQRWGVTRLPRKTHRGLRKVACIGAWHPARVKW 806
            V +DAVFQ +EMID I +TKG G +GVV RWGVTRLPRKTHRGLRKVACIGAWHPARV +
Sbjct: 206  VPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSY 265

Query: 807  TVARAGQQGFHHRTEINKKVYKIGKKGDASHLATTEFDVTKKEITPMGGFPHYGVVSEDY 986
            TVARAGQ G+HHRTE+NKKVYKIGK G  +H A+TEFD T+K+ITPMGGFPHYGVV  DY
Sbjct: 266  TVARAGQNGYHHRTEMNKKVYKIGKVGQETHDASTEFDRTEKDITPMGGFPHYGVVKADY 325

Query: 987  LMIKGCVPGTKKRAITLRRSLLPQTSRNALEEVKLKFIDTASKFGHGRFQTTEEKLKTFG 1166
            LMIKGC  G KKR +TLR+SLL QTSR ALEE+KLKF+DT+SKFGHGRFQTT+EK + +G
Sbjct: 326  LMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFVDTSSKFGHGRFQTTDEKQRFYG 385

Query: 1167 RTKA 1178
            + KA
Sbjct: 386  KLKA 389

 Score =  118 bits (295), Expect(3) = e-112
 Identities = 71/158 (44%), Positives = 91/158 (56%), Gaps = 2/158 (1%)
 Frame = +2

Query: 158 KAGMTHIVRDVEKPGSKAAQEVRPASRSPSSSALPWSWSGAVGYVKTPRGLRSLNTVWAE 337
           KAGMTHIVR+VEKPGSK  ++             P    G V YVKTPRGLR+LN+VWA+
Sbjct: 50  KAGMTHIVREVEKPGSKLHKK-ETCEAVTIVETPPIVIVGLVAYVKTPRGLRTLNSVWAQ 108

Query: 338 HLSRGR*SAGSTRTGTSPRRRASPMYAKKYSD--GKKAIEAELAALKKHCCGDPWCWRTP 511
           HLS         +     +++A   YA KY    GKK I+ +L  +KK+         T 
Sbjct: 109 HLSEDV-RRRFYKNWCKSKKKAFTKYALKYDSDAGKKEIQMQLEKMKKYATVVRVIAHTQ 167

Query: 512 QVKKLGFGVKKAHLMEVQVNGGTVAQKVDFAYSMFEKQ 625
             K  G   KKAHLME+Q+NGGT+A KVD+ Y+ FEK+
Sbjct: 168 IRKMKGLKQKKAHLMEIQINGGTIADKVDYGYNFFEKE 205

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 57/139 (41%), Positives = 70/139 (50%), Gaps = 5/139 (3%)
 Frame = +1

Query: 7   MSHRKFEHPRSCARWASAPASAAAAARAR*SRSPVDDASKPVHLTAFMG*QGRHDSHRPR 186
           MSHRKFEHPR        P    +  R +    P DD SK  HLTAF+G +    +H  R
Sbjct: 1   MSHRKFEHPRH-GSLGFLPRKRCSRHRGKVKAFPRDDQSKKCHLTAFLGYKAGM-THIVR 58

Query: 187 CGEAWLQGCTRSETCEPVTIIECPPMVVVWCGRLREDPP-----RSALAEHRLG*APEPR 351
             E       + ETCE VTI+E PP+V+V      + P       S  A+H         
Sbjct: 59  EVEKPGSKLHKKETCEAVTIVETPPIVIVGLVAYVKTPRGLRTLNSVWAQHL------SE 112

Query: 352 EVKRRFYKNWYKSKKKGFT 408
           +V+RRFYKNW KSKKK FT
Sbjct: 113 DVRRRFYKNWCKSKKKAFT 131

 Score = 40.4 bits (93), Expect(3) = e-112
 Identities = 18/29 (62%), Positives = 21/29 (72%)
 Frame = +3

Query: 45  SLGFSPRKRCRRGKGKVKSFPRGRCLQAC 131
           SLGF PRKRC R +GKVK+FPR    + C
Sbjct: 13  SLGFLPRKRCSRHRGKVKAFPRDDQSKKC 41

>gb|AAQ21397.1| ribosomal protein L3 [Triticum aestivum] gi|34105766|gb|AAQ62074.1|
            ribosomal protein L3 [Triticum aestivum]
          Length = 389

 Score =  294 bits (752), Expect(3) = e-112
 Identities = 139/184 (75%), Positives = 158/184 (85%)
 Frame = +3

Query: 627  VSVDAVFQPNEMIDTIAITKGHGVQGVVQRWGVTRLPRKTHRGLRKVACIGAWHPARVKW 806
            V V+AVFQ +EM+D I +TKG G +GVV RWGVTRLPRKTHRGLRKVACIGAWHPARV +
Sbjct: 206  VPVEAVFQKDEMVDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSY 265

Query: 807  TVARAGQQGFHHRTEINKKVYKIGKKGDASHLATTEFDVTKKEITPMGGFPHYGVVSEDY 986
            TVARAGQ G+HHRTE+NKK+YK+GK G  SH A TEFD T+K+ITPMGGFPHYGVV  DY
Sbjct: 266  TVARAGQNGYHHRTEMNKKIYKMGKSGQESHEACTEFDRTEKDITPMGGFPHYGVVKGDY 325

Query: 987  LMIKGCVPGTKKRAITLRRSLLPQTSRNALEEVKLKFIDTASKFGHGRFQTTEEKLKTFG 1166
            LMIKGC  G KKR +TLR+SLL QTSR ALEE+KLKFIDT+SKFGHGRFQTT+EK K +G
Sbjct: 326  LMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTDEKQKFYG 385

Query: 1167 RTKA 1178
            + KA
Sbjct: 386  KLKA 389

 Score =  117 bits (294), Expect(3) = e-112
 Identities = 71/158 (44%), Positives = 90/158 (56%), Gaps = 2/158 (1%)
 Frame = +2

Query: 158 KAGMTHIVRDVEKPGSKAAQEVRPASRSPSSSALPWSWSGAVGYVKTPRGLRSLNTVWAE 337
           KAGMTHIVR+VEKPGSK  ++             P    G V YVKTPRGLR+LN+VWA+
Sbjct: 50  KAGMTHIVREVEKPGSKLHKK-ETCEAVTIIETPPLVIVGLVAYVKTPRGLRTLNSVWAQ 108

Query: 338 HLSRGR*SAGSTRTGTSPRRRASPMYAKKYSD--GKKAIEAELAALKKHCCGDPWCWRTP 511
           HLS         +     +++A   YA KY    GKK I+ +L  +KK+         T 
Sbjct: 109 HLSEDV-RRRFYKNWCKSKKKAFTKYALKYDSDSGKKEIQLQLEKMKKYATIVRVIAHTQ 167

Query: 512 QVKKLGFGVKKAHLMEVQVNGGTVAQKVDFAYSMFEKQ 625
             K  G   KKAHLME+Q+NGGT+A KVD+ Y  FEK+
Sbjct: 168 IRKMKGLKQKKAHLMEIQINGGTIADKVDYGYKFFEKE 205

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 58/139 (41%), Positives = 70/139 (49%), Gaps = 5/139 (3%)
 Frame = +1

Query: 7   MSHRKFEHPRSCARWASAPASAAAAARAR*SRSPVDDASKPVHLTAFMG*QGRHDSHRPR 186
           MSHRKFEHPR        P    +  R +    P DD  KP HLTAF+G +    +H  R
Sbjct: 1   MSHRKFEHPRH-GSLGFLPRKRCSRHRGKVKSFPKDDQQKPCHLTAFLGYKAGM-THIVR 58

Query: 187 CGEAWLQGCTRSETCEPVTIIECPPMVVVWCGRLREDPP-----RSALAEHRLG*APEPR 351
             E       + ETCE VTIIE PP+V+V      + P       S  A+H         
Sbjct: 59  EVEKPGSKLHKKETCEAVTIIETPPLVIVGLVAYVKTPRGLRTLNSVWAQHL------SE 112

Query: 352 EVKRRFYKNWYKSKKKGFT 408
           +V+RRFYKNW KSKKK FT
Sbjct: 113 DVRRRFYKNWCKSKKKAFT 131

 Score = 40.4 bits (93), Expect(3) = e-112
 Identities = 18/29 (62%), Positives = 21/29 (72%)
 Frame = +3

Query: 45  SLGFSPRKRCRRGKGKVKSFPRGRCLQAC 131
           SLGF PRKRC R +GKVKSFP+    + C
Sbjct: 13  SLGFLPRKRCSRHRGKVKSFPKDDQQKPC 41

>ref|NP_175009.1| 60S ribosomal protein L3 (RPL3A) [Arabidopsis thaliana]
            gi|27735225|sp|P17094|RL3A_ARATH 60S ribosomal protein L3
            gi|25295007|pir||E96498 L3 cytoplasmic ribosomal protein
            [imported] - Arabidopsis thaliana
            gi|3617741|gb|AAC36018.1| L3 cytoplasmic ribosomal
            protein [Arabidopsis thaliana]
            gi|11935191|gb|AAG42011.1|AF327421_1 putative ribosomal
            protein [Arabidopsis thaliana]
            gi|13487800|gb|AAK27726.1|AF361101_1 putative ribosomal
            protein [Arabidopsis thaliana]
            gi|13605657|gb|AAK32822.1|AF361809_1 At1g43170/F1I21_18
            [Arabidopsis thaliana] gi|14517418|gb|AAK62599.1|
            At1g43170/F1I21_18 [Arabidopsis thaliana]
            gi|15450559|gb|AAK96457.1| At1g43170/F1I21_18
            [Arabidopsis thaliana] gi|15982761|gb|AAL09721.1|
            At1g43170/F1I21_18 [Arabidopsis thaliana]
          Length = 389

 Score =  282 bits (721), Expect(3) = e-112
 Identities = 129/181 (71%), Positives = 155/181 (85%)
 Frame = +3

Query: 627  VSVDAVFQPNEMIDTIAITKGHGVQGVVQRWGVTRLPRKTHRGLRKVACIGAWHPARVKW 806
            + ++AVFQ +EMID I +TKG G +GVV RWGVTRLPRKTHRGLRKVACIGAWHPARV +
Sbjct: 206  IPIEAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSY 265

Query: 807  TVARAGQQGFHHRTEINKKVYKIGKKGDASHLATTEFDVTKKEITPMGGFPHYGVVSEDY 986
            TVARAGQ G+HHRTE+NKK+Y++GK G  +H A TE+D T+K++TPMGGFPHYG+V +DY
Sbjct: 266  TVARAGQNGYHHRTELNKKIYRLGKVGTEAHTAMTEYDRTEKDVTPMGGFPHYGIVKDDY 325

Query: 987  LMIKGCVPGTKKRAITLRRSLLPQTSRNALEEVKLKFIDTASKFGHGRFQTTEEKLKTFG 1166
            LMIKGC  G KKR +TLR+SLL QTSR ALEE+KLKFIDTAS FGHGRFQT+ EK++ + 
Sbjct: 326  LMIKGCCVGPKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHGRFQTSLEKMRFYN 385

Query: 1167 R 1169
            R
Sbjct: 386  R 386

 Score =  132 bits (333), Expect(3) = e-112
 Identities = 80/162 (49%), Positives = 99/162 (60%), Gaps = 6/162 (3%)
 Frame = +2

Query: 158 KAGMTHIVRDVEKPGSKAAQ----EVRPASRSPSSSALPWSWSGAVGYVKTPRGLRSLNT 325
           KAGMTHIVR+VEKPGSK  +    E      +P+   +     G V YVKTPRGLRSLNT
Sbjct: 50  KAGMTHIVREVEKPGSKLHKKETCEAVTIIETPAMVVV-----GVVAYVKTPRGLRSLNT 104

Query: 326 VWAEHLSRGR*SAGSTRTGTSPRRRASPMYAKKYS--DGKKAIEAELAALKKHCCGDPWC 499
           VWA+HLS         +     +++A   YAK+Y   DGKK I+A+L  +KK+       
Sbjct: 105 VWAQHLSE-EVRRRFYKNWAKSKKKAFTGYAKQYDSEDGKKGIQAQLEKMKKYATVIRVL 163

Query: 500 WRTPQVKKLGFGVKKAHLMEVQVNGGTVAQKVDFAYSMFEKQ 625
             T   K  G   KKAH+ME+Q+NGGT+AQKVDFAYS FEKQ
Sbjct: 164 AHTQIRKMKGLKQKKAHMMEIQINGGTIAQKVDFAYSFFEKQ 205

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 67/170 (39%), Positives = 85/170 (49%), Gaps = 2/170 (1%)
 Frame = +1

Query: 7   MSHRKFEHPRSCARWASAPASAAAAARAR*SRSPVDDASKPVHLTAFMG*QGRHDSHRPR 186
           MSHRKFEHPR        P   A   R +    P DD +KP   TAFMG +    +H  R
Sbjct: 1   MSHRKFEHPRH-GSLGFLPRKRANRHRGKVKAFPKDDQTKPCKFTAFMGYKAGM-THIVR 58

Query: 187 CGEAWLQGCTRSETCEPVTIIECPPMVVVWCGRLREDPPRSALAEHRLG*APEPREVKRR 366
             E       + ETCE VTIIE P MVVV      +  PR   + + +       EV+RR
Sbjct: 59  EVEKPGSKLHKKETCEAVTIIETPAMVVVGVVAYVK-TPRGLRSLNTVWAQHLSEEVRRR 117

Query: 367 FYKNWYKSKKKGFTNVRQEVQRRQEGHRGRAGRPEEALLR*SV--VLAHT 510
           FYKNW KSKKK FT   ++    ++G +G   + E+     +V  VLAHT
Sbjct: 118 FYKNWAKSKKKAFTGYAKQYD-SEDGKKGIQAQLEKMKKYATVIRVLAHT 166

 Score = 36.6 bits (83), Expect(3) = e-112
 Identities = 16/29 (55%), Positives = 20/29 (68%)
 Frame = +3

Query: 45  SLGFSPRKRCRRGKGKVKSFPRGRCLQAC 131
           SLGF PRKR  R +GKVK+FP+    + C
Sbjct: 13  SLGFLPRKRANRHRGKVKAFPKDDQTKPC 41



EST assemble image


clone accession position
1 HC056g09_r AV636232 1 620
2 HC011a07_r AV632661 7 681
3 HC051c03_r AV635806 9 618
4 HC019d11_r AV633320 9 701
5 MX225h10_r BP090581 12 558
6 HC055d06_r AV636119 16 658
7 MXL085e02_r BP098022 16 561
8 HC053h02_r AV635998 18 549
9 HC048e07_r AV635612 19 650
10 HC013a12_r AV632826 23 684
11 MXL071e07_r BP097190 26 544
12 LC068b05_r AV623749 31 729
13 HCL088b12_r AV644420 36 672
14 HC086d03_r AV638436 69 662
15 CM057c03_r AV390433 98 674
16 MX212b08_r BP089683 104 598
17 HC070f10_r AV637251 104 639
18 MX217a12_r BP089989 105 459
19 CM071h06_r AV391345 105 776
20 CM032c01_r AV388498 105 583
21 CM077f05_r AV391750 105 761
22 CM063a08_r AV390103 105 794
23 CM040f11_r AV389226 105 716
24 CM014d04_r AV387374 105 770
25 HCL069a12_r AV643402 106 701
26 LC009c04_r AV619505 106 744
27 HC086e06_r AV638447 106 600
28 HCL033d01_r AV641422 106 556
29 HC041d07_r AV635061 107 704
30 HC007e10_r AV632387 107 693
31 CM037b04_r AV388879 107 681
32 LC065g04_r AV623568 107 715
33 CM005g05_r AV386878 107 745
34 CM004g05_r AV386654 107 748
35 CM014g05_r AV387372 107 622
36 HC032d03_r AV634357 108 684
37 HC088g04_r AV638630 108 614
38 HC045f06_r AV635380 108 646
39 LCL002d08_r AV626103 108 547
40 LCL032b09_r AV627796 108 724
41 MX251d02_r BP092230 109 661
42 MX009b08_r BP086455 109 574
43 LC021d06_r AV620379 109 615
44 LC006b12_r AV619290 109 720
45 LC030d12_r AV621050 109 600
46 LC078c02_r AV624475 109 634
47 LC031g12_r AV621144 109 699
48 LC056g11_r AV622939 109 714
49 LC064e09_r AV623488 109 686
50 LC089c12_r AV625211 110 704
51 HC087g08_r AV638549 111 579
52 HCL082c11_r AV644122 111 654
53 HC005e02_r AV632222 112 697
54 CM100h11_r AV392832 112 356
55 HC018f12_r AV633264 112 704
56 MX014b10_r BP086675 112 474
57 HC051g12_r AV635853 112 630
58 HC028f01_r AV634049 112 690
59 HC035c11_r AV634590 112 639
60 HC091b05_r AV638812 112 586
61 MX051f06_r BP088103 112 523
62 HC019c12_r AV633313 112 704
63 HC099d10_r AV639443 112 696
64 HC010g10_r AV632647 112 690
65 MX206f04_r BP089403 112 650
66 HC049d11_r AV635678 112 646
67 HC019h11_r AV633363 112 685
68 HC077b03_r AV637756 112 546
69 HC034c12_r AV634509 112 692
70 CM026h05_r AV387555 112 810
71 CM006a12_r AV387196 112 742
72 CM054f11_r AV390038 112 429
73 HC080d01_r AV637991 112 691
74 MX240c12_r BP091523 112 716
75 HC072f02_r AV637394 112 690
76 HC045f08_r AV635381 112 596
77 HC064f11_r AV636821 112 714
78 LC012d02_r AV619733 112 716
79 HC012b09_r AV632753 112 686
80 MX219a08_r BP090119 112 471
81 HC053e06_r AV635973 112 603
82 MX218a11_r BP090053 112 475
83 CM058a10_r AV390338 112 808
84 MX041b09_r BP087676 112 614
85 MX250d08_r BP092154 112 603
86 MX059a05_r BP088380 112 520
87 HC073b03_r AV637434 112 719
88 CM023h02_r AV387771 112 790
89 HC026a05_r AV633844 112 705
90 HC067h11_r AV637045 112 601
91 HC034g04_r AV634541 112 680
92 HC027g05_r AV633985 112 718
93 HC029e10_r AV634123 112 704
94 CM064c12_r AV391011 112 769
95 MX002b07_r BP086111 112 663
96 HC038h05_r AV634859 112 729
97 HC065g09_r AV636898 112 626
98 HC074b02_r AV637517 112 627
99 HC030e11_r AV634211 112 672
100 LC092a11_r AV625402 112 696
101 HC084f09_r AV638304 112 734
102 HC046g05_r AV635472 112 640
103 MX204g05_r BP089308 112 634
104 HC048d05_r AV635601 112 699
105 HC040c02_r AV634967 112 636
106 MXL032d07_r BP094916 113 405
107 MX249f11_r BP092093 113 536
108 MX259b04_r BP092784 113 659
109 MXL038c04_r BP095220 113 566
110 MX248e12_r BP092027 113 745
111 MX246d08_r BP091920 113 718
112 MX256d10_r BP092595 113 710
113 MX245h01_r BP091894 113 681
114 MX254h02_r BP092488 113 660
115 HC007g02_r AV632398 113 690
116 LC019d10_r AV620242 113 714
117 HC036e10_r AV634690 113 671
118 MX249h01_r BP092105 113 738
119 LC088d02_r AV625136 113 722
120 HC007b09_r AV632358 114 704
121 MX241b03_r BP091567 114 699
122 HC097a03_r AV639254 115 607
123 MX257b03_r BP092640 115 708
124 MX059b03_r BP088385 115 528
125 LC085f11_r AV625007 115 453
126 HC075c04_r AV637601 115 626
127 MX041g03_r BP087701 115 437
128 HC083f05_r AV638234 115 438
129 HC043c05_r AV635201 115 647
130 MX061e04_r BP088480 115 517
131 HC024g01_r AV633744 115 690
132 HC059g07_r AV636461 115 646
133 HC089d04_r AV638681 115 604
134 HC086g10_r AV638472 115 670
135 HC041d11_r AV635065 115 693
136 HC088h10_r AV638643 115 707
137 HC098h12_r AV639408 115 598
138 LC043f02_r AV621988 115 715
139 HC024e05_r AV633727 115 741
140 HC067a03_r AV636980 115 635
141 CM052b10_r AV390517 115 757
142 MX008b02_r BP086403 115 597
143 MX005c09_r BP086263 115 634
144 CM065g07_r AV391153 115 815
145 CM003f05_r AV386578 115 684
146 HC032a05_r AV634331 115 689
147 MXL015a12_r BP093880 115 413
148 MX237a05_r BP091328 116 308
149 HC079a10_r AV637897 116 632
150 LC055a04_r AV622816 116 713
151 MX019b02_r BP086867 116 657
152 HC093f02_r AV638998 116 699
153 MX231h12_r BP090976 117 634
154 CM041c05_r AV389455 117 758
155 CM083c01_r AV392154 117 575
156 CM077g03_r AV391766 117 768
157 HCL008f09_r AV640006 119 616
158 HCL064g05_r AV643155 119 558
159 CM031e10_r AV388360 119 372
160 CM025e02_r AV388070 119 800
161 HC048e02_r AV635608 119 638
162 HCL042c11_r AV641912 119 693
163 CM066h05_r AV390874 119 423
164 MX210h12_r BP089628 119 483
165 CM011b09_r AV386903 119 618
166 HC083e08_r AV638226 119 634
167 CM010d03_r AV386992 119 584
168 HCL047g01_r AV642221 119 725
169 CM042f11_r AV389305 119 445
170 HCL063g05_r AV643101 119 689
171 HC010b10_r AV632599 119 699
172 CM090f06_r AV392319 119 679
173 HC017f03_r AV633172 119 690
174 CM031a12_r AV388309 119 425
175 CM040d01_r AV389153 120 763
176 MX052b03_r BP088118 120 715
177 HC082b02_r AV638112 120 718
178 HC095f03_r AV639149 120 691
179 CL44d12_r AV395584 120 705
180 CM008g07_r AV386728 121 737
181 HC086b01_r AV638415 121 616
182 HC074f05_r AV637557 121 728
183 HC045f04_r AV635379 121 716
184 MX252e12_r BP092322 121 629
185 HC062c08_r AV636643 121 715
186 HC006c06_r AV632282 121 702
187 MX208f10_r BP089507 121 547
188 HC027h06_r AV633996 121 729
189 HC030c10_r AV634188 121 686
190 HC042h01_r AV635172 121 698
191 MXL009h11_r BP093547 121 503
192 CM004e03_r AV386638 121 519
193 CM033d07_r AV388421 121 618
194 LCL041d10_r AV628414 121 662
195 MX210a04_r BP089575 121 643
196 MX037a04_r BP087542 122 631
197 MX260d11_r BP092887 122 697
198 LC048d06_r AV622342 122 726
199 HCL035g06_r AV641538 123 552
200 CM053e01_r AV389932 124 750
201 HC045e08_r AV635372 125 662
202 CM004f08_r AV386670 125 765
203 CM050b03_r AV389756 125 535
204 CM062e12_r AV390114 125 725
205 CM085d10_r AV392401 125 778
206 MX056f07_r BP088295 125 702
207 CM040f01_r AV389155 125 776
208 HC048b03_r AV635578 125 729
209 MX045f02_r BP087877 126 686
210 HC007f09_r AV632393 127 715
211 HC028f06_r AV634053 127 698
212 HC046f02_r AV635460 127 728
213 HC049g09_r AV635704 127 666
214 CM025h08_r AV388062 128 831
215 HC036g12_r AV634710 132 690
216 MX250d03_r BP092150 132 719
217 CM096a12_r AV392740 132 659
218 CM094c07_r AV393290 136 744
219 MX214d10_r BP089823 136 603
220 HC021e07_r AV633500 139 708
221 MX250g10_r BP092184 140 743
222 MX229d11_r BP090811 142 608
223 MX015a05_r BP086711 143 605
224 HC032f04_r AV634377 149 705
225 HC097f09_r AV639308 152 726
226 HC099f09_r AV639461 154 707
227 HC097d05_r AV639285 155 640
228 HC058a03_r AV636323 155 733
229 LC045f09_r AV622290 156 710
230 HC062a04_r AV636624 160 672
231 HC031c10_r AV634273 160 758
232 CM044h05_r AV389540 177 823
233 CM052a02_r AV390496 182 787
234 LC012c06_r AV619725 197 812
235 CM097c05_r AV393239 199 675
236 LC064d09_r AV623482 199 709
237 HC058f01_r AV636368 215 808
238 CM081c05_r AV391913 227 868
239 CM023a07_r AV387784 227 897
240 CM055e04_r AV390259 241 938
241 LC098h08_r AV625855 252 810
242 CM068a10_r AV391040 260 853
243 MX225c10_r BP090533 262 645
244 HC018a07_r AV633207 263 870
245 HC068a06_r AV637052 272 699
246 CM035e06_r AV388747 274 867
247 MX211e12_r BP089658 280 754
248 LC088h07_r AV625177 285 797
249 CM083a07_r AV392193 285 657
250 CM089a01_r AV392224 295 662
251 CM063e03_r AV390043 298 968
252 HC088b07_r AV638578 306 757
253 MXL023g08_r BP094484 306 652
254 CM081h06_r AV391897 318 973
255 MX206d11_r BP089394 318 721
256 HC033e03_r AV634446 319 873
257 CM011b01_r AV386891 322 920
258 CM097e06_r AV393193 337 931
259 LC073e03_r AV624141 338 883
260 MX023g05_r BP087045 344 770
261 CL26d10_r AV394623 346 915
262 CM023f12_r AV387749 346 1001
263 LC030a04_r AV621017 360 944
264 LC077d05_r AV624408 364 916
265 MX040b10_r BP087645 365 707
266 HC060g02_r AV636533 370 974
267 HC089h05_r AV638718 373 836
268 MXL084e02_r BP097976 380 926
269 HC014e07_r AV632932 382 916
270 HCL026f01_r AV641035 392 836
271 LC076e04_r AV624347 393 989
272 MX064d04_r BP088588 408 792
273 HC020e08_r AV633414 415 940
274 LC085h06_r AV625022 416 917
275 HC040g06_r AV635009 419 977
276 HC080g03_r AV638019 431 921
277 CM019d03_r AV387298 435 1007
278 CM056h04_r AV390301 435 1088
279 CM037e02_r AV388840 437 970
280 LCL059a11_r AV629458 445 1002
281 MX238g11_r BP091442 448 913
282 MX223h12_r BP090442 448 785
283 CM086g06_r AV392511 451 1009
284 HC005e03_r AV632223 459 1021
285 HC041e01_r AV635067 461 985
286 LCL090d09_r AV631218 472 903
287 MX249c08_r BP092065 474 1048
288 HC015h03_r AV633032 478 1021
289 HC089c07_r AV638673 478 917
290 CM041c06_r AV389442 492 1047
291 LC020h04_r AV620347 499 1033
292 LC033d10_r AV621252 510 1050
293 CM071a08_r AV391375 518 1110
294 HC076d11_r AV637704 525 985
295 CL11a05_r AV393763 533 1070
296 CM043c06_r AV389510 533 795
297 MX058e10_r BP088355 538 1043
298 HC093g07_r AV639009 544 982
299 HC029a06_r AV634081 551 1088
300 CM084e06_r AV392609 560 1085
301 LC062f01_r AV623357 566 1047
302 HC020d05_r AV633399 574 926
303 CM029d09_r AV389335 583 1254
304 CM096e03_r AV392732 587 1081
305 CM012g12_r AV387125 590 1163
306 CM100d01_r AV392796 591 1136
307 CM077e01_r AV391745 605 1133
308 HC002g04_r AV632003 653 1023
309 MX041e08_r BP087689 678 1065
310 CM048b07_r AV389071 682 952
311 CM096a01_r AV392754 691 1049
312 HC006d12_r AV632298 725 1230
313 HC026h07_r AV633918 737 1225
314 MX236a02_r BP091249 819 1106
315 CL18g02_r AV394044 828 1418
316 HC085h12_r AV638405 836 1262
317 CM067d12_r AV390925 875 1473
318 CL26a05_r AV394599 880 1338
319 MXL054a07_r BP096173 924 1331
320 CM096f02_r AV392746 965 1340
321 CL30f02_r AV394742 986 1507
322 CM080h10_r AV392063 1024 1622
323 CM081h02_r AV391893 1029 1602
324 HC024h03_r AV633756 1033 1514
325 LC006b08_r AV619287 1039 1544
326 CM029h07_r AV389367 1040 1624
327 CM041g03_r AV389426 1051 1605
328 CL13c10_r AV393927 1074 1570
329 CL65a06_r AV396595 1080 1615
330 CM071b06_r AV391339 1085 1576
331 CL08c07_r AV393513 1093 1579
332 CM001a04_r AV386458 1095 1621
333 CL25e12_r AV394560 1103 1248
334 HCL095f12_r AV644935 1125 1356
335 HCL095g01_r AV644936 1125 1551
336 HC012a07_r AV632742 1146 1624
337 LC020c01_r AV620296 1154 1684
338 LC008f06_r AV619461 1162 1682
339 LC046e07_r AV622204 1166 1648
340 LC051d01_r AV622569 1166 1660
341 LC048e05_r AV622351 1171 1688
342 CM021d12_r AV387982 1180 1622
343 MX002e10_r BP086135 1188 1546
344 LC073g04_r AV624159 1193 1607
345 MX254d04_r BP092447 1202 1615
346 HC085c11_r AV638353 1202 1685
347 HC093c08_r AV638974 1229 1595
348 MX056e11_r BP088293 1237 1544
349 HC012a06_r AV632741 1245 1698
350 CM099g11_r AV393169 1263 1617
351 LC089c02_r AV625203 1273 1668
352 MX219b01_r BP090121 1335 1615
353 HC077h05_r AV637814 1413 1876
354 LC097c08_r AV625745 1443 1615




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research