KCC000168A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000168A_C01 KCC000168A_c01
GTGGCATTTAAATCTCCGCCACGCCCCCAAATTTGCGCCCGCGTGGACTAATAGAGACTG
CTTTTCCAGCAACCAATAGCCCGCACCAAATGAAGACACGCCATGCAGGGGAACTTAGCC
AACATTTCGGAGGCTAGTGAGCACTTGCCAGAAAGCTTATCACCCACAGGAGCGTTGCTG
AGCGGCGCTCCTCACCTAGCCGCGCACGACGCCGCAGAGCTGCGCAGCCCAGCGGCGACA
GAGCAGGGAGTGGAGTCAGCGGTTCGCAGCCCGCGCCAGGATGCCGCGTCAGGTGCTGTC
GCCGCTGGTGAAGCCGGATTGTGTGAGCGCATGAGCGGCGGCAGCGGTGTGTCGGTGCCG
AGCGGTGCACCTGCGGAGGCGGCTGAGCCACCACAGGTCAGGACCTACTTGAGCAGTTCT
GCCTCGCCGGGTTTGCTGCTGTATGGGATAGGGGGAGGTGTGGCGGGCACATCAGGTGCC
GTGCGTGGTGCCCC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000168A_C01 KCC000168A_c01
         (494 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||S35047 mucin JUL7 - human gi|407082|emb|CAA52408.1| mucin [...    41  0.009
emb|CAD27316.1| hypothetical protein [Aspergillus fumigatus]           41  0.009
ref|XP_240330.2| similar to KIAA0975 protein [Rattus norvegicus]       40  0.016
dbj|BAB68105.1| B1088C09.12 [Oryza sativa (japonica cultivar-gro...    40  0.016
ref|XP_039877.6| similar to Mucin 5B precursor (Mucin 5 subtype ...    40  0.016

>pir||S35047 mucin JUL7 - human gi|407082|emb|CAA52408.1| mucin [Homo sapiens]
          Length = 543

 Score = 40.8 bits (94), Expect = 0.009
 Identities = 30/111 (27%), Positives = 51/111 (45%)
 Frame = -1

Query: 488 PRTAPDVPATPPPIPYSSKPGEAELLK*VLTCGGSAASAGAPLGTDTPLPPLMRSHNPAS 309
           P ++     TPP +  ++           +T  GS  +  +  GT TP+PP++ S    +
Sbjct: 446 PSSSTQTSGTPPSLTTTAT---------TITATGSTTNPSSTPGT-TPIPPVLTS-TATT 494

Query: 308 PAATAPDAASWRGLRTADSTPCSVAAGLRSSAASCAAR*GAPLSNAPVGDK 156
           PAAT+  A S    RTA + P   +   +S+A S       P+ ++P G +
Sbjct: 495 PAATSSKATSSSSPRTATTLPVLTSTATKSTATSF-----TPIPSSPCGPR 540

 Score = 33.5 bits (75), Expect = 1.5
 Identities = 27/94 (28%), Positives = 40/94 (41%), Gaps = 3/94 (3%)
 Frame = -1

Query: 479 APDVPATPP-PIPYSSKPGEAELLK*VLTCGGSAA--SAGAPLGTDTPLPPLMRSHNPAS 309
           AP  PA  P P P   +PG +  L   ++    +   S   P    T  PP + +    +
Sbjct: 11  APRPPALRPCPPPLRGRPGSSTELAPTISHYDCSPLDSTATPSTPGTAPPPKVLTSPATT 70

Query: 308 PAATAPDAASWRGLRTADSTPCSVAAGLRSSAAS 207
           P AT+  A S    RTA + P   +   +S+A S
Sbjct: 71  PTATSSKATSSSSPRTATTLPVLTSTATKSTATS 104

>emb|CAD27316.1| hypothetical protein [Aspergillus fumigatus]
          Length = 588

 Score = 40.8 bits (94), Expect = 0.009
 Identities = 34/116 (29%), Positives = 46/116 (39%), Gaps = 18/116 (15%)
 Frame = -1

Query: 491 APRTAPDVPA----TPPPIPYSSKPGEAELLK*VLTCGGSAASAGAPLGTDTPLP----- 339
           A R A   PA     PPP+P  SKP   E +K   +    AA+ GA  GT + +P     
Sbjct: 253 ASRNATPAPAPSAQNPPPLPVESKPSVTEAVKASTSQSAQAAALGAGPGTPSKVPPTGPK 312

Query: 338 --------PLMRSHNPASPAATAPDAASWRGLRTADSTPCS-VAAGLRSSAASCAA 198
                   P+     P  PA   P  AS  G   +     S +    R++ A+ AA
Sbjct: 313 GSRAQSAIPVTNLPKPPIPAVANPPLASVPGNNVSQGPALSAITEATRAATAAVAA 368

>ref|XP_240330.2| similar to KIAA0975 protein [Rattus norvegicus]
          Length = 1673

 Score = 40.0 bits (92), Expect = 0.016
 Identities = 28/95 (29%), Positives = 39/95 (40%), Gaps = 1/95 (1%)
 Frame = +1

Query: 151  ESLSPTGALLSGAPHLAAHDAAELRSPAATEQGVES-AVRSPRQDAASGAVAAGEAGLCE 327
            ES + T A    A    A   +   +PAA E   E+ A      +A + A +A EA    
Sbjct: 1103 ESAAETPATAESAAEAPAAAESAAEAPAAAESAAEAPAAAESAAEAPAAAESAAEAPAAA 1162

Query: 328  RMSGGSGVSVPSGAPAEAAEPPQVRTYLSSSASPG 432
              S  +G   P+GAPA A  P   +    + A  G
Sbjct: 1163 EASAPAGAPAPAGAPAPAGAPAGAQAPAPAGAPAG 1197

 Score = 35.4 bits (80), Expect = 0.39
 Identities = 33/111 (29%), Positives = 45/111 (39%)
 Frame = +1

Query: 160  SPTGALLSGAPHLAAHDAAELRSPAATEQGVESAVRSPRQDAASGAVAAGEAGLCERMSG 339
            +P  A  +     AA  AAE  +PAA E   E+   +   ++A+ A AA EA        
Sbjct: 1118 APAAAESAAEAPAAAESAAE--APAAAESAAEAPAAA---ESAAEAPAAAEASAPAGAPA 1172

Query: 340  GSGVSVPSGAPAEAAEPPQVRTYLSSSASPGLLLYGIGGGVAGTSGAVRGA 492
             +G   P+GAPA A  P        + A    L    G      +GA  GA
Sbjct: 1173 PAGAPAPAGAPAGAQAPAPAGAPAGAPAGAQAL---AGAQAPAPAGAPAGA 1220

>dbj|BAB68105.1| B1088C09.12 [Oryza sativa (japonica cultivar-group)]
          Length = 637

 Score = 40.0 bits (92), Expect = 0.016
 Identities = 42/133 (31%), Positives = 60/133 (44%), Gaps = 1/133 (0%)
 Frame = -1

Query: 470 VPATPPPIPYSSKPGEAELLK-*VLTCGGSAASAGAPLGTDTPLPPLMRSHNPASPAATA 294
           + ATPPP+   S P  A   +  V   GGS A A AP   D P P   RS        T 
Sbjct: 59  IAATPPPLTPVSVPANASSPETPVDASGGSNAGATAPT-RDAPQPDRSRS--------TP 109

Query: 293 PDAASWRGLRTADSTPCSVAAGLRSSAASCAAR*GAPLSNAPVGDKLSGKCSLASEMLAK 114
           P A   RG    + T   V+AG   + A+ AA  G  + +  V +   GK  +A++ +  
Sbjct: 110 PAAVGVRGSAGTNGTSRGVSAGGDGAGAAAAAAAGVAVPSWEVCE--VGKGVVAADYI-- 165

Query: 113 FPCMACLHLVRAI 75
            PC+  +  V+A+
Sbjct: 166 -PCLDNVKAVKAL 177

>ref|XP_039877.6| similar to Mucin 5B precursor (Mucin 5 subtype B, tracheobronchial)
            (High molecular weight salivary mucin MG1) (Sublingual
            gland mucin) [Homo sapiens]
          Length = 5858

 Score = 40.0 bits (92), Expect = 0.016
 Identities = 31/94 (32%), Positives = 42/94 (43%), Gaps = 4/94 (4%)
 Frame = -1

Query: 476  PDVPATPPPIPYSSKPGEAELLK*VLTCGGSAASAGA---PLGTDTPLPPLMRSHNPAS- 309
            P  PAT      SS PG   +L  + T   + AS G+   P  T    PP     +PA+ 
Sbjct: 4325 PSTPATSSTAMPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTAPPPKVLTSPATT 4384

Query: 308  PAATAPDAASWRGLRTADSTPCSVAAGLRSSAAS 207
            P AT+  A S    RTA + P   +   +S+A S
Sbjct: 4385 PTATSSKATSSSSPRTATTLPVLTSTATKSTATS 4418

 Score = 38.5 bits (88), Expect = 0.046
 Identities = 29/94 (30%), Positives = 41/94 (42%), Gaps = 4/94 (4%)
 Frame = -1

Query: 476  PDVPATPPPIPYSSKPGEAELLK*VLTCGGSAASAGA---PLGTD-TPLPPLMRSHNPAS 309
            P  PAT      SS PG   +L    T   + A+ G+   P  T  T  PP + +    +
Sbjct: 3123 PSTPATSSTATPSSTPGTTWILTEQTTAATTTATTGSTAIPSSTPGTAPPPKVLTSTATT 3182

Query: 308  PAATAPDAASWRGLRTADSTPCSVAAGLRSSAAS 207
            P AT+  A S    RTA + P   +   +S+A S
Sbjct: 3183 PTATSSKATSSSSPRTATTLPVLTSTATKSTATS 3216

 Score = 35.8 bits (81), Expect = 0.30
 Identities = 26/94 (27%), Positives = 43/94 (45%)
 Frame = -1

Query: 488  PRTAPDVPATPPPIPYSSKPGEAELLK*VLTCGGSAASAGAPLGTDTPLPPLMRSHNPAS 309
            P ++     TPP +  ++           +T  GS  +  +  GT TP+ P++ S    +
Sbjct: 4763 PSSSTQTSGTPPSLTTTAT---------TITATGSTTNPSSTPGT-TPITPVLTS-TATT 4811

Query: 308  PAATAPDAASWRGLRTADSTPCSVAAGLRSSAAS 207
            PAAT+  A S    RTA + P   +   +S+A S
Sbjct: 4812 PAATSSKATSSSSPRTATTLPVLTSTATKSTATS 4845

 Score = 34.3 bits (77), Expect = 0.87
 Identities = 29/107 (27%), Positives = 44/107 (41%), Gaps = 2/107 (1%)
 Frame = -1

Query: 476  PDVPATPPPIPYSSKPGEAELLK*VLTCGGSAASAGAPLGTDTPLPPLMRSHNP--ASPA 303
            P  PAT      SS PG   +L    T   + AS G+   T TP   L  +  P   +  
Sbjct: 2037 PSTPATSSTATPSSTPGTTWILTKPTTTATTTASTGS---TATPTSTLRTAPPPKVLTTT 2093

Query: 302  ATAPDAASWRGLRTADSTPCSVAAGLRSSAASCAAR*GAPLSNAPVG 162
            AT P   S +   ++     +    LRS+A +  A    P+ ++ +G
Sbjct: 2094 ATTPTVTSSKATPSSSPGTATALPALRSTATTPTATSVTPIPSSSLG 2140



EST assemble image


clone accession position
1 LCL040f10_r AV628369 1 352
2 HCL012d12_r AV640222 1 234
3 HCL041h12_r AV641891 10 366
4 HCL078d02_r AV643915 10 495
5 CL08c04_r AV393505 10 480
6 HCL037a10_r AV641596 14 464
7 LCL094c08_r AV631454 48 333




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research