KCC000167A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000167A_C02 KCC000167A_c02
TTCGAGTTCGGGACCCCGGCTTGCGCCCATCTTGCTCGCACTTTGATCCTCAAAGACCGC
TTGCCGCGCGGCACTTCGCAGAATCCTGGCCTCAGGCCCAATACTTAAACTCGTTTTAGC
AAGCTCCAGGCCCTCGCGGTGCTTCAAGGGAGGCCGCGTCGTGCCGGAACGGCGAAATGG
GCTTGGCCTGGGCTTTGGACCCGGCCGTCCTCGGCCAGGTCTTCGCTGCGATCCTGCCTG
TGTGGCTTCTTGGCGCTCTGACTGGCTATCTGATTCCCCGGCCTGCGCCGGGCAAGACTC
CAAGCGCTACTAGCTGGGCCCTCTTTCTGTCGGGAACGGGCTTCCGTCGATGGGCCATCG
TCTACCACCTCTGTATCATTGTCCGGGACTTCTGGCGGACCTACTGCGCGCCGGGGACGT
TCCGCGCCTTCTGCAAAGCCGTGGTCAGCTGGGCGAGCGGCAAAGGCTTTAACTTCGAGT
TCCCAGCGGTCGCTGCGGATGGCAGCTCCGTTGCTGAGGTTGGCACGAAGAGCGAGCGCG
ACGCTGACAACTGGTATGTCACGCAGAAGGACCTGGCCTTCTTTCAGTACCACATGGAGC
AGGGCGGTGTCAGCGAGGGCGCCTCGCCCTGGGAGGTGCTGATGGAGAAGGAGGTGCCCA
ACCTGATCAAATACGTCGCTTACCGCCGCACCCTCAAGAGCGGCAAGACGGAGTACAAAA
GTGTTACCTACAGCCCGGACGCCACCGCCCAGGAGTTCATGGACCTGTACTTTGACGACG
ACTTCCGCCCCAAATGGGATACCATGATCATCCACCACGAGGTGCTGGAGCACGGCGACT
TTGCGCAGCGCCAGCAGGTGGTGCGCTGGACGCGCCGCTTCCCCTTCAAGTTCCTGTCGG
ACCGCGAGTACACCATCGCGCGCCGTCTGTTTAAGACGGACGACGCCTTGTACGGCCTGA
CCAAGGTCATCGACCACCCCAGCTCGCAGCGCGACACCCAGGTGGTGAAGATGGACGTCT
TCTACAGCATGTGGCGCTCTCGCACTGTGGAGTGCCCCTGGGGCAGCGGCAAGGCCGCCT
GCGAGACGGTGCTGCTGCACCACGAGCAGTTTAAGATCATGGAGAACCTGGCGCGCTTCG
CCGTGCGCCACGGCATGTGGGGCTTCGTGCGCAACCTGGCGGAACGCACGCCCGA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000167A_C02 KCC000167A_c02
         (1195 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAL57201.1|AF355597_1 putative nodule membrane protein [Medic...   149  7e-35
ref|NP_566722.1| expressed protein [Arabidopsis thaliana] gi|929...   144  3e-33
ref|NP_567433.1| expressed protein [Arabidopsis thaliana] gi|162...   143  7e-33
gb|AAL07016.1| unknown protein [Arabidopsis thaliana]                 143  7e-33
gb|AAM91533.1| membrane related protein CP5, putative [Arabidops...   141  2e-32

>gb|AAL57201.1|AF355597_1 putative nodule membrane protein [Medicago sativa]
          Length = 424

 Score =  149 bits (377), Expect = 7e-35
 Identities = 86/218 (39%), Positives = 122/218 (55%), Gaps = 1/218 (0%)
 Frame = +3

Query: 528  KSERDADNWYVTQKDLAFFQYHMEQGGVSEGASPWEVLMEKEVPNLIKYVAYRRTLKSGK 707
            KS  D  N  VT  DL      +E+    +G  PW  +M+K  P +  Y A+RR  K G 
Sbjct: 110  KSGEDTSNG-VTINDLHHLYKLVEE---KDGGLPWIQMMDKSTPTM-SYQAWRREPKDGP 164

Query: 708  TEYKSVTYSPDATAQEFMDLYFDDDFRPKWDTMIIHHEVLEHGDFAQRQQVVRWTRRFPF 887
             +Y+S T   DAT +   DL++DD FRPKWD M+++   LE        + V+W R+FPF
Sbjct: 165  PQYRSSTIFEDATPEMVRDLFWDDQFRPKWDDMLVNSTTLEECPTTGTMK-VQWIRKFPF 223

Query: 888  KFLSDREYTIARRLFKTDDALYGLTKVIDHPSSQRDTQVVKMDVFYSMWRSRTVECPWGS 1067
             F  DREY I RR+++   + Y +TK +D PS  R  +  ++DV+YS W  R VE    +
Sbjct: 224  -FCKDREYIIGRRIWECGRSYYCVTKGVDCPSIPRQEKPRRVDVYYSSWCIRAVESKRDN 282

Query: 1068 GK-AACETVLLHHEQFKIMENLARFAVRHGMWGFVRNL 1178
            G+  ACE +L HHE+  I   +A+  VR GMWG V+ +
Sbjct: 283  GQLTACEVLLFHHEEMGIPWEIAKLGVRKGMWGMVQKI 320

>ref|NP_566722.1| expressed protein [Arabidopsis thaliana] gi|9294197|dbj|BAB02099.1|
            membrane related protein-like [Arabidopsis thaliana]
            gi|23297764|gb|AAN13021.1| unknown protein [Arabidopsis
            thaliana]
          Length = 419

 Score =  144 bits (363), Expect = 3e-33
 Identities = 103/326 (31%), Positives = 159/326 (48%), Gaps = 6/326 (1%)
 Frame = +3

Query: 219  VFAAILPVW---LLGALTGYLIPRPAPGKTPSATSWALFLSGTGFRRWAIVYHLCIIVRD 389
            V    +P+W   ++G L G+          P  TS    L   GFR  + +  LC +   
Sbjct: 20   VLLCAVPIWVTVMIGLLIGW-------SWRPRWTS----LVYLGFR--SKLRFLCTVPPG 66

Query: 390  FW--RTYCAPGTFRAFCKAVVSWASGKGFNFEFPAVAADGSSVAEVGTKSERDADNWYVT 563
            F   R + A     AF     S  S        P      S  ++  T+ E+D     VT
Sbjct: 67   FGARRIWLAFTALSAFSVCSTSNKSSVNNGSSKPVEEEAFSRASDKVTEKEKDV----VT 122

Query: 564  QKDLAFFQYHMEQGGVSEGASPWEVLMEKEVPNLIKYVAYRRTLKSGKTEYKSVTYSPDA 743
            +KDL    + +E G  S     W+ +M+K  PN+  Y A+R   + G   Y+S T   D 
Sbjct: 123  EKDLEHLLHLLEAGNAS---FEWQSMMDKSTPNM-SYQAWRHEPEIGPVVYRSRTVFEDV 178

Query: 744  TAQEFMDLYFDDDFRPKWDTMIIHHEVLEHGDFAQRQQVVRWTRRFPFKFLSDREYTIAR 923
            T     D ++DD+FRPKWDTM+ + + LE  D      +V W ++FPF F SDREY I R
Sbjct: 179  TPDIVRDFFWDDEFRPKWDTMLAYFKTLEE-DPKTGTTIVHWIKKFPF-FCSDREYIIGR 236

Query: 924  RLFKTDDALYGLTKVIDHPSSQRDTQVVKMDVFYSMWRSRTVECPWGSGK-AACETVLLH 1100
            R++++    Y +TK + + +  +  +  ++++++S W    VE   G G+  ACE  L+H
Sbjct: 237  RIWESGRKYYAVTKGVPYKALSKRDKPRRVELYFSSWIINAVESRKGDGQMTACEVSLVH 296

Query: 1101 HEQFKIMENLARFAVRHGMWGFVRNL 1178
            +E   I +++A+  VRHGMWG V+ L
Sbjct: 297  YEDMGIPKDVAKLGVRHGMWGAVKKL 322

>ref|NP_567433.1| expressed protein [Arabidopsis thaliana]
            gi|16226251|gb|AAL16115.1|AF428283_1 AT4g14500/dl3290w
            [Arabidopsis thaliana] gi|22531042|gb|AAM97025.1|
            expressed protein [Arabidopsis thaliana]
            gi|31376367|gb|AAP49510.1| At4g14500 [Arabidopsis
            thaliana]
          Length = 433

 Score =  143 bits (360), Expect = 7e-33
 Identities = 82/233 (35%), Positives = 131/233 (56%), Gaps = 1/233 (0%)
 Frame = +3

Query: 483  PAVAADGSSVAEVGTKSERDADNWYVTQKDLAFFQYHMEQGGVSEGASPWEVLMEKEVPN 662
            P    D S +A  G+ +    ++  VT+ DL      +E G     A  W+ +M+K  PN
Sbjct: 113  PVEDNDESGLASRGSDNGTVTED-IVTENDLEHLLQLLEVGNA---ALEWQSMMDKTTPN 168

Query: 663  LIKYVAYRRTLKSGKTEYKSVTYSPDATAQEFMDLYFDDDFRPKWDTMIIHHEVLEHGDF 842
            +  Y A+R   ++G   Y+S T   DAT     D ++DD+FRPKWD M+ + + LE  D 
Sbjct: 169  M-SYQAWRHEPETGPVIYRSRTVFEDATPDIVRDFFWDDEFRPKWDFMLANFKTLEE-DT 226

Query: 843  AQRQQVVRWTRRFPFKFLSDREYTIARRLFKTDDALYGLTKVIDHPSSQRDTQVVKMDVF 1022
                 +V+W ++FPF F SDREY I RR++++    Y +TK + +P+  +  +  +++++
Sbjct: 227  QTGTMIVQWRKKFPF-FCSDREYIIGRRIWESGKKYYCVTKGVPYPALPKRDKPRRVELY 285

Query: 1023 YSMWRSRTVECPWGSG-KAACETVLLHHEQFKIMENLARFAVRHGMWGFVRNL 1178
            +S W  R VE   G G + ACE  L+H+E   I +++A+  VRHGMWG V+ L
Sbjct: 286  FSSWVIRAVESRKGDGQQTACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKL 338

>gb|AAL07016.1| unknown protein [Arabidopsis thaliana]
          Length = 419

 Score =  143 bits (360), Expect = 7e-33
 Identities = 103/326 (31%), Positives = 158/326 (47%), Gaps = 6/326 (1%)
 Frame = +3

Query: 219  VFAAILPVW---LLGALTGYLIPRPAPGKTPSATSWALFLSGTGFRRWAIVYHLCIIVRD 389
            V    +P+W   ++G L G+          P  TS    L   GFR  + +  LC +   
Sbjct: 20   VLLCAVPIWVTVMIGLLIGW-------SWRPRWTS----LVYLGFR--SKLRFLCTVPPG 66

Query: 390  FW--RTYCAPGTFRAFCKAVVSWASGKGFNFEFPAVAADGSSVAEVGTKSERDADNWYVT 563
            F   R + A     AF     S  S        P      S  ++  T  E+D     VT
Sbjct: 67   FGARRIWLAFTALSAFSVCSTSNKSSVNNGSSKPVEEEAFSRASDKVTGKEKDV----VT 122

Query: 564  QKDLAFFQYHMEQGGVSEGASPWEVLMEKEVPNLIKYVAYRRTLKSGKTEYKSVTYSPDA 743
            +KDL    + +E G  S     W+ +M+K  PN+  Y A+R   + G   Y+S T   D 
Sbjct: 123  EKDLEHLLHLLEAGNAS---FEWQSMMDKSTPNM-SYQAWRHEPEIGPVVYRSRTVFEDV 178

Query: 744  TAQEFMDLYFDDDFRPKWDTMIIHHEVLEHGDFAQRQQVVRWTRRFPFKFLSDREYTIAR 923
            T     D ++DD+FRPKWDTM+ + + LE  D      +V W ++FPF F SDREY I R
Sbjct: 179  TPDIVRDFFWDDEFRPKWDTMLAYFKTLEE-DPKTGTTIVHWIKKFPF-FCSDREYIIGR 236

Query: 924  RLFKTDDALYGLTKVIDHPSSQRDTQVVKMDVFYSMWRSRTVECPWGSGK-AACETVLLH 1100
            R++++    Y +TK + + +  +  +  ++++++S W    VE   G G+  ACE  L+H
Sbjct: 237  RIWESGRKYYAVTKGVPYKALSKRDKPRRVELYFSSWIINAVESRKGDGQMTACEVSLVH 296

Query: 1101 HEQFKIMENLARFAVRHGMWGFVRNL 1178
            +E   I +++A+  VRHGMWG V+ L
Sbjct: 297  YEDMGIPKDVAKLGVRHGMWGAVKKL 322

>gb|AAM91533.1| membrane related protein CP5, putative [Arabidopsis thaliana]
            gi|23197608|gb|AAN15331.1| membrane related protein CP5,
            putative [Arabidopsis thaliana]
          Length = 385

 Score =  141 bits (356), Expect = 2e-32
 Identities = 84/242 (34%), Positives = 127/242 (51%), Gaps = 1/242 (0%)
 Frame = +3

Query: 456  SGKGFNFEFPAVAADGSSVAEVGTKSERDADNWYVTQKDLAFFQYHMEQGGVSEGASPWE 635
            S K  N + P      SS     + S ++    +VT  D   F++  +   V +G   W 
Sbjct: 56   SPKFLNLQLPTSILKTSSHHVNPSLSSKEKTG-FVTDDD---FRHLWKLVEVKDGGPCWI 111

Query: 636  VLMEKEVPNLIKYVAYRRTLKSGKTEYKSVTYSPDATAQEFMDLYFDDDFRPKWDTMIIH 815
             +M++  P    Y A+RR  ++G  +Y+S T   DAT +   D ++DD+FR KWD M+++
Sbjct: 112  QMMDRSTPTF-SYQAWRRDPENGPPQYRSRTVFEDATPEMVRDFFWDDEFRSKWDDMLLY 170

Query: 816  HEVLEHGDFAQRQQVVRWTRRFPFKFLSDREYTIARRLFKTDDALYGLTKVIDHPSSQRD 995
               LE         VV+W R+FPF F SDREY I RR++      Y +TK + +PS  R 
Sbjct: 171  SSTLERCKDTGTM-VVQWVRKFPF-FCSDREYIIGRRIWDAGRVFYCITKGVQYPSVPRQ 228

Query: 996  TQVVKMDVFYSMWRSRTVECPWGSGK-AACETVLLHHEQFKIMENLARFAVRHGMWGFVR 1172
             +  ++D++YS W  R VE   G G+  +CE +L HHE   I   +A+  VR GMWG V+
Sbjct: 229  NKPRRVDLYYSSWCIRAVESKRGDGEMTSCEVLLFHHEDMGIPWEIAKLGVRQGMWGAVK 288

Query: 1173 NL 1178
             +
Sbjct: 289  KI 290



EST assemble image


clone accession position
1 LCL033b05_r AV627870 1 488
2 LCL022g10_r AV627214 3 459
3 LCL087g07_r AV631026 6 539
4 LCL085c07_r AV630856 9 281
5 LCL032f01_r AV627825 9 337
6 LCL016f08_r AV626850 9 263
7 LCL012b05_r AV626601 29 552
8 LCL023h03_r AV627257 91 484
9 LCL014a04_r AV626705 92 379
10 LCL087h08_r AV631035 93 545
11 LCL098c05_r AV631689 96 479
12 LCL065e08_r AV629764 98 558
13 HC056b08_r AV636180 104 242
14 CL08b08_r AV393533 105 622
15 HCL071h09_r AV643568 118 588
16 LC045d04_r AV622075 202 679
17 LC060c03_r AV623195 483 973
18 MXL087e08_r BP098120 533 911
19 MXL077g03_r BP097559 684 1065
20 LCL018e08_r AV626943 693 1195
21 LCL064d09_r AV629718 724 1176




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research