KCC000166A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000166A_C01 KCC000166A_c01
cagcaccaggagcattacagtcctcgtcccatcccCATGCCCCGAGGGTGCGCTCCCAAC
GCATCCACACAGCAGCCATCCAACGGCTGGGCGCCCCAACAACAAACACCGCTCATTCCT
CGCGGCCTCAACCAGCAGCGTGTAGCGTTGCCCCGCATCATCCAGCGGCAGCGGCAGCAC
CACGTCCAGGCAGTAGCGGCGCGGAGACCGTGGCTCAGACCCCGAGCCAACACACCGCAT
CTGTCACAACCCTCCACAGCAGCTCGGGCCCTATACAGCAGCTCAGCGGCGGCCTCACCT
GGCACTGTTCCGAGCAGCGACTCACCGTCGAGAAAATGACCACGAGGTTCAAGAAGAACC
GCAAGAAGCGCGGTCACGTCAGCGCCGGCCATGGTCGCGTTGTGCAAGCACCGCAAGCAC
CCAGGTGGTCGCGGTAACGCTGGTGGCCAGCACCACCACCGCATTATGATGGACAAGTAC
CACCCTGGCTTCTTCGGCAAGGTCGGTATGCGCCACTTCCACTACGCGCGGAACAAGTAC
CACTGCCCCATCATCAACCTGGACAAGCTCTGGACCCTGGTTGGCGAGGAGGCCCGCGAG
CAGGCTGCCAAGGACAAGAGCTCGGCCGCCGTCATCGACGTGACCAAGTACGGCATCAGC
AAGGTCCTGGGCAAGGGCCAGCTGCCCGAGCAGCCCGTGGTGGTGAAGGCCAAGTTCTTC
TCCTCCCTGGCGGAGAAGAAGATCCGCGCCGTCGGCGGCGACTGCATCCTCACCGCCTAA
GCGTGTGCGCGGCTTTGCGTGTGTCGCGTCTGGGGCTCGGCGGCCCGTGGTTTGCGTCGT
GTGTGCGCCGCATTTGCGCGCGTAGCTGCCCAGCTGCGCAATAGAGAGGTCCAGTCGGCG
CTCGTTCGCGGATGTACCTGCCCGGCGTGGGCGCTCAAGGAGCGATGGCGCGGCGGCGCG
CCGGTGAATGCCACGGCTGTGTAAAGTGCACAATCGcc


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000166A_C01 KCC000166A_c01
         (998 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_177217.1| 60S ribosomal protein L27A (RPL27aC) [Arabidops...   175  5e-51
dbj|BAA96068.1| 60S ribosomal protein L27a [Panax ginseng]            177  8e-51
gb|AAM62795.1| 60S ribosomal protein L27A [Arabidopsis thaliana]      174  1e-50
gb|AAD13388.1| ribosomal protein L27a [Petunia x hybrida]             173  2e-50
ref|NP_000981.1| ribosomal protein L27a; 60S ribosomal protein L...   187  2e-50

>ref|NP_177217.1| 60S ribosomal protein L27A (RPL27aC) [Arabidopsis thaliana]
           gi|1710530|sp|P49637|R27C_ARATH 60S ribosomal protein
           L27a-3 gi|2129719|pir||S71256 ribosomal protein L27a,
           cytosolic - Arabidopsis thaliana
           gi|1107487|emb|CAA63025.1| 60S ribosomal protein L27a
           [Arabidopsis thaliana]
           gi|12324756|gb|AAG52338.1|AC011663_17 60S ribosomal
           protein L27A; 82981-83421 [Arabidopsis thaliana]
           gi|12325037|gb|AAG52464.1|AC010796_3 60S ribosomal
           protein L27A; 71521-71081 [Arabidopsis thaliana]
           gi|14517370|gb|AAK62576.1| At1g70600/F5A18_22
           [Arabidopsis thaliana] gi|15081672|gb|AAK82491.1|
           At1g70600/F5A18_22 [Arabidopsis thaliana]
           gi|20147177|gb|AAM10305.1| At1g70600/F5A18_22
           [Arabidopsis thaliana]
          Length = 146

 Score =  175 bits (444), Expect(2) = 5e-51
 Identities = 82/125 (65%), Positives = 99/125 (78%), Gaps = 1/125 (0%)
 Frame = +1

Query: 406 KHRKHPGGRGNAGGQHHHRIMMDKYHPGFFGKVGMRHFHYARNKYHCPIINLDKLWTLVG 585
           KHRKHPGGRGNAGG HHHRI+ DKYHPG+FGKVGMR+FH  RNK+ CPI+NLDKLW+LV 
Sbjct: 24  KHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRNKFFCPIVNLDKLWSLVP 83

Query: 586 EEAREQAAKDKSSAAVIDVTKYGISKVLGKGQLPE-QPVVVKAKFFSSLAEKKIRAVGGD 762
           E+ + ++ KD  +  +IDVT++G  KVLGKG LPE +P VVKAK  S  AEKKI+  GG 
Sbjct: 84  EDVKAKSTKD--NVPLIDVTQHGFFKVLGKGHLPENKPFVVKAKLISKTAEKKIKEAGGA 141

Query: 763 CILTA 777
            +LTA
Sbjct: 142 VVLTA 146

 Score = 49.3 bits (116), Expect(2) = 5e-51
 Identities = 21/22 (95%), Positives = 22/22 (99%)
 Frame = +3

Query: 336 MTTRFKKNRKKRGHVSAGHGRV 401
           MTTRFKKNRKKRGHVSAGHGR+
Sbjct: 1   MTTRFKKNRKKRGHVSAGHGRI 22

>dbj|BAA96068.1| 60S ribosomal protein L27a [Panax ginseng]
          Length = 146

 Score =  177 bits (448), Expect(2) = 8e-51
 Identities = 82/125 (65%), Positives = 101/125 (80%), Gaps = 1/125 (0%)
 Frame = +1

Query: 406 KHRKHPGGRGNAGGQHHHRIMMDKYHPGFFGKVGMRHFHYARNKYHCPIINLDKLWTLVG 585
           KHRKHPGGRGNAGG HHHRI+ DKYHPG+FGKVGMR+FH  RNK++CP++N+DKLW+L+ 
Sbjct: 24  KHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHRLRNKFYCPVVNIDKLWSLLP 83

Query: 586 EEAREQAAKDKSSAAVIDVTKYGISKVLGKGQLP-EQPVVVKAKFFSSLAEKKIRAVGGD 762
           +EA+E+A  D  +A VIDVT++G  KVLGKG LP   P+VVKAK  S  AEKKI+  GG 
Sbjct: 84  QEAKEKA--DAQNAPVIDVTQHGYFKVLGKGFLPSSHPIVVKAKLVSKTAEKKIKEAGGA 141

Query: 763 CILTA 777
            +LTA
Sbjct: 142 VVLTA 146

 Score = 47.0 bits (110), Expect(2) = 8e-51
 Identities = 20/22 (90%), Positives = 21/22 (94%)
 Frame = +3

Query: 336 MTTRFKKNRKKRGHVSAGHGRV 401
           MTTRFKKN KKRGHVSAGHGR+
Sbjct: 1   MTTRFKKNXKKRGHVSAGHGRI 22

>gb|AAM62795.1| 60S ribosomal protein L27A [Arabidopsis thaliana]
          Length = 146

 Score =  174 bits (440), Expect(2) = 1e-50
 Identities = 82/125 (65%), Positives = 98/125 (77%), Gaps = 1/125 (0%)
 Frame = +1

Query: 406 KHRKHPGGRGNAGGQHHHRIMMDKYHPGFFGKVGMRHFHYARNKYHCPIINLDKLWTLVG 585
           KHRKHPGGRGNAGG HHHRI+ DKYHPG+FGKVGMR+FH  RNK+ CPI+NLDKLW+LV 
Sbjct: 24  KHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRNKFFCPIVNLDKLWSLVP 83

Query: 586 EEAREQAAKDKSSAAVIDVTKYGISKVLGKGQLPE-QPVVVKAKFFSSLAEKKIRAVGGD 762
           E+ +  A   K++  +IDVT++G  KVLGKG LPE +P VVKAK  S  AEKKI+  GG 
Sbjct: 84  EDVK--AKSTKNNVPLIDVTQHGFFKVLGKGHLPENKPFVVKAKLISKTAEKKIKEAGGA 141

Query: 763 CILTA 777
            +LTA
Sbjct: 142 VVLTA 146

 Score = 49.3 bits (116), Expect(2) = 1e-50
 Identities = 21/22 (95%), Positives = 22/22 (99%)
 Frame = +3

Query: 336 MTTRFKKNRKKRGHVSAGHGRV 401
           MTTRFKKNRKKRGHVSAGHGR+
Sbjct: 1   MTTRFKKNRKKRGHVSAGHGRI 22

>gb|AAD13388.1| ribosomal protein L27a [Petunia x hybrida]
          Length = 150

 Score =  173 bits (439), Expect(2) = 2e-50
 Identities = 82/127 (64%), Positives = 100/127 (78%), Gaps = 3/127 (2%)
 Frame = +1

Query: 406 KHRKHPGGRGNAGGQHHHRIMMDKYHPGFFGKVGMRHFHYARNKYHCPIINLDKLWTLVG 585
           KHRKHPGGRGNAGG HHHRI+ DKYHPG+FGKVGMR+FH  RNK++CP +N+DKLW+LV 
Sbjct: 24  KHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRNKFYCPTVNIDKLWSLVP 83

Query: 586 EEAREQAAKD--KSSAAVIDVTKYGISKVLGKGQLPE-QPVVVKAKFFSSLAEKKIRAVG 756
           ++ +++ A    K +A +IDVT+YG  KVLGKG LPE Q VVVKAK  S  AEKKI+  G
Sbjct: 84  QDVKDKVAAGGAKGTAPLIDVTQYGYFKVLGKGVLPENQAVVVKAKLVSKNAEKKIKEAG 143

Query: 757 GDCILTA 777
           G  +LTA
Sbjct: 144 GAVVLTA 150

 Score = 49.3 bits (116), Expect(2) = 2e-50
 Identities = 21/22 (95%), Positives = 22/22 (99%)
 Frame = +3

Query: 336 MTTRFKKNRKKRGHVSAGHGRV 401
           MTTRFKKNRKKRGHVSAGHGR+
Sbjct: 1   MTTRFKKNRKKRGHVSAGHGRI 22

>ref|NP_000981.1| ribosomal protein L27a; 60S ribosomal protein L27a [Homo sapiens]
           gi|1173017|sp|P46776|RL2A_HUMAN 60S ribosomal protein
           L27a gi|1362930|pir||S55914 ribosomal protein L27a -
           human gi|550017|gb|AAA85656.1| ribosomal protein L27a
           gi|4760602|dbj|BAA77361.1| ribosomal protein L27A [Homo
           sapiens] gi|13529098|gb|AAH05326.1| Ribosomal protein
           L27a [Homo sapiens] gi|1096940|prf||2113200C ribosomal
           protein L27a
          Length = 148

 Score =  187 bits (476), Expect(2) = 2e-50
 Identities = 86/125 (68%), Positives = 103/125 (81%), Gaps = 1/125 (0%)
 Frame = +1

Query: 406 KHRKHPGGRGNAGGQHHHRIMMDKYHPGFFGKVGMRHFHYARNKYHCPIINLDKLWTLVG 585
           KHRKHPGGRGNAGG HHHRI  DKYHPG+FGKVGM+H+H  RN+  CP +NLDKLWTLV 
Sbjct: 24  KHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKHYHLKRNQSFCPTVNLDKLWTLVS 83

Query: 586 EEAREQAAKDKSSAA-VIDVTKYGISKVLGKGQLPEQPVVVKAKFFSSLAEKKIRAVGGD 762
           E+ R  AAK+K+ AA +IDV + G  KVLGKG+LP+QPV+VKAKFFS  AE+KI++VGG 
Sbjct: 84  EQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSVGGA 143

Query: 763 CILTA 777
           C+L A
Sbjct: 144 CVLVA 148

 Score = 34.7 bits (78), Expect(2) = 2e-50
 Identities = 14/22 (63%), Positives = 17/22 (76%)
 Frame = +3

Query: 336 MTTRFKKNRKKRGHVSAGHGRV 401
           M +R +K RK RGHVS GHGR+
Sbjct: 1   MPSRLRKTRKLRGHVSHGHGRI 22



EST assemble image


clone accession position
1 LC012h10_r AV619768 1 501
2 MX025h07_r BP087119 276 764
3 MXL070f12_r BP097137 367 903
4 MXL085a05_r BP097997 367 821
5 HC058a05_r AV636325 368 850
6 MXL062b12_r BP096639 368 784
7 MXL073f03_r BP097317 368 733
8 LC023c10_r AV620528 368 925
9 MXL084g08_r BP097989 369 757
10 MXL067a08_r BP096915 370 790
11 MXL092d04_r BP098370 370 781
12 MXL095d06_r BP098557 370 896
13 MXL061a12_r BP096579 371 711
14 MX051g08_r BP088106 371 814
15 LCL048f04_r AV628896 371 671
16 CM059e01_r AV390645 371 982
17 CM012c05_r AV387169 371 861
18 CS001e05_r AV398011 371 937
19 MXL013g02_r BP093785 372 650
20 MX008c03_r BP086410 372 827
21 MX052b06_r BP088119 373 750
22 MXL040f01_r BP095362 374 911
23 MXL015e12_r BP093916 375 719
24 MXL066f07_r BP096894 375 900
25 MXL031g12_r BP094892 375 740
26 HC061e07_r AV636589 375 935
27 MXL021b02_r BP094315 375 728
28 MXL046g08_r BP095746 375 773
29 MXL090b08_r BP098250 375 757
30 MXL057c07_r BP096353 375 780
31 MXL059g06_r BP096502 375 863
32 MXL005h01_r BP093262 375 887
33 MX017d02_r BP086811 375 899
34 HC084b12_r AV638273 375 849
35 CM025f10_r AV388080 375 1010
36 HC081a05_r AV638036 375 836
37 MXL011b01_r BP093623 375 691
38 MXL003g11_r BP093128 375 710
39 MX045b04_r BP087859 375 878
40 HC029a11_r AV634086 375 929
41 MXL047c06_r BP095779 375 865
42 MXL024d01_r BP094517 375 740
43 MX061d09_r BP088477 375 744
44 MX235a02_r BP091176 376 668
45 CL17f08_r AV394126 376 928
46 HC044g08_r AV635315 377 847
47 CM009c07_r AV397641 377 1050
48 MXL045a05_r BP095637 377 800
49 HC071e07_r AV637314 377 871
50 HC001g06_r AV631925 377 932
51 HCL061d01_r AV642964 377 929
52 MXL007c09_r BP093355 377 825
53 MXL046c08_r BP095712 379 805
54 CL58h05_r AV396229 380 936
55 CL08a12_r AV393538 380 928
56 HCL013d02_r AV640263 380 710
57 MX034f03_r BP087439 381 793
58 CM036f01_r AV388777 381 683
59 MX008c12_r BP086415 382 788
60 HCL013g04_r AV640287 382 758
61 MXL017c10_r BP094041 382 731
62 MXL093c03_r BP098434 382 781
63 HCL055a06_r AV642628 382 923
64 MXL025c10_r BP094587 383 822
65 MXL090g02_r BP098278 383 905
66 HC079f07_r AV637940 385 544
67 MXL051g12_r BP096058 388 790
68 MXL100b11_r BP098852 389 696
69 MXL097g01_r BP098707 395 735
70 MXL060h10_r BP096570 398 795
71 HCL061b08_r AV642954 411 922
72 HCL022c11_r AV640781 416 921
73 HCL093a11_r AV644733 416 864
74 MXL026f02_r BP094658 440 717
75 CL30a01_r AV394745 469 1016
76 CL19h03_r AV394188 496 1016
77 CL60c10_r AV396388 497 1016
78 CS001c06_r AV397984 523 1075
79 CL57a11_r AV396266 534 1079
80 CL08a06_r AV393518 550 1086
81 CL50e11_r AV395753 564 915
82 CM090c10_r AV392292 580 1077
83 HCL020b02_r AV640662 946 1115




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research