KCC000165A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000165A_C01 KCC000165A_c01
CTGAAATACCTCTGCCAAGTGCCTTTTCTGCAAGTGAGCGGCCGATAAGTGATTGCAGCC
TCTCGGTCACCTTTGCTTTCCTACATCTTCGCGGAGCGTGCGTGACAATGGGCCTATACA
ACGTTACCATCCCTGAGCGGATGAGCCTCCCTGAAACGGTCGGGTGCTCATCGCGGTGCC
TGCCGCGCCCTCAGCCCCGTCTACTACGCGCTGGCCGCCAGCCGGCTCGGCCGGTGGTTC
GCACCCGTGTGTACACGCCCACTCGCGCCGAGGAGCAGACCGCCCTTCGGCTGGAGGCGC
AGCTCGCGCCCGCGAACCTGCTCAGCGAAATCCTGGCGCCTGTGACAGCGGATATGCAGC
AAATGAACACCAACCTGAAGAACGTGGTGGGCAACAGGCATCCGATGCTGATGGCAGCGG
CGGAGCAGATCTTTGGGGCCGGTGGAAAGAAGCTCCGGCCAGTCATCGTCTTTCTGGTCG
CACACTGCACGGCGCAGCGCGAGGGCCTAACAGAGCTGACCGAGAAG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000165A_C01 KCC000165A_c01
         (527 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||F96813 hypothetical protein T30F21.15 [imported] - Arabidop...    76  2e-13
ref|NP_177972.2| geranyl diphosphate synthase (GPPS)(dimethylall...    76  2e-13
ref|NP_484140.1| solanesyl diphosphate synthase [Nostoc sp. PCC ...    73  2e-12
ref|NP_173148.2| geranyl diphosphate synthase (GPPS)(dimethylall...    72  4e-12
pir||C86306 prenyl transferase homolog [imported] - Arabidopsis ...    72  4e-12

>pir||F96813 hypothetical protein T30F21.15 [imported] - Arabidopsis thaliana
           gi|4836881|gb|AAD30584.1|AC007260_15 Very similar to
           prenyltransferases [Arabidopsis thaliana]
          Length = 390

 Score = 76.3 bits (186), Expect = 2e-13
 Identities = 35/60 (58%), Positives = 48/60 (79%)
 Frame = +3

Query: 342 VTADMQQMNTNLKNVVGNRHPMLMAAAEQIFGAGGKKLRPVIVFLVAHCTAQREGLTELT 521
           V  D+Q +N NL ++VG  +P+L++AAEQIFGAGGK++RP +VFLV+H TA+  GL ELT
Sbjct: 75  VAVDLQTLNDNLLSIVGAENPVLISAAEQIFGAGGKRMRPGLVFLVSHATAELAGLKELT 134

>ref|NP_177972.2| geranyl diphosphate synthase (GPPS)(dimethylallyltransferase),
           putative [Arabidopsis thaliana]
           gi|19911233|dbj|BAB86941.1| solanesyl diphosphate
           synthase [Arabidopsis thaliana]
          Length = 406

 Score = 76.3 bits (186), Expect = 2e-13
 Identities = 35/60 (58%), Positives = 48/60 (79%)
 Frame = +3

Query: 342 VTADMQQMNTNLKNVVGNRHPMLMAAAEQIFGAGGKKLRPVIVFLVAHCTAQREGLTELT 521
           V  D+Q +N NL ++VG  +P+L++AAEQIFGAGGK++RP +VFLV+H TA+  GL ELT
Sbjct: 91  VAVDLQTLNDNLLSIVGAENPVLISAAEQIFGAGGKRMRPGLVFLVSHATAELAGLKELT 150

>ref|NP_484140.1| solanesyl diphosphate synthase [Nostoc sp. PCC 7120]
           gi|25314336|pir||AH1818 solanesyl diphosphate synthase
           [imported] - Nostoc sp.  (strain PCC 7120)
           gi|17135074|dbj|BAB77620.1| solanesyl diphosphate
           synthase [Nostoc sp. PCC 7120]
          Length = 323

 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 32/63 (50%), Positives = 46/63 (72%)
 Frame = +3

Query: 324 SEILAPVTADMQQMNTNLKNVVGNRHPMLMAAAEQIFGAGGKKLRPVIVFLVAHCTAQRE 503
           + +  PV AD++ +  NLK +VGNRHP+L AAAE +FGAGGK++RP IV L++  T   +
Sbjct: 5   TSLFTPVEADLRILADNLKQLVGNRHPILFAAAEHLFGAGGKRIRPAIVLLISRATMLDQ 64

Query: 504 GLT 512
           G+T
Sbjct: 65  GIT 67

>ref|NP_173148.2| geranyl diphosphate synthase (GPPS)(dimethylallyltransferase),
           putative [Arabidopsis thaliana]
           gi|34327936|dbj|BAC82428.1| solanesyl diphosphate
           synthase [Arabidopsis thaliana]
          Length = 417

 Score = 72.0 bits (175), Expect = 4e-12
 Identities = 36/84 (42%), Positives = 54/84 (63%)
 Frame = +3

Query: 270 EEQTALRLEAQLAPANLLSEILAPVTADMQQMNTNLKNVVGNRHPMLMAAAEQIFGAGGK 449
           ++   L L  +      L  +   V  D+Q++N NL ++VG  +P+L++AAEQIF AGGK
Sbjct: 78  DQTVMLNLRQESRKPISLETLFEVVADDLQRLNDNLLSIVGAENPVLISAAEQIFSAGGK 137

Query: 450 KLRPVIVFLVAHCTAQREGLTELT 521
           ++RP +VFLV+  TA+  GL ELT
Sbjct: 138 RMRPGLVFLVSRATAELAGLKELT 161

>pir||C86306 prenyl transferase homolog [imported] - Arabidopsis thaliana
           gi|5734760|gb|AAD50025.1|AC007651_20 Very similar to
           prenyl transferase [Arabidopsis thaliana]
          Length = 379

 Score = 72.0 bits (175), Expect = 4e-12
 Identities = 36/84 (42%), Positives = 54/84 (63%)
 Frame = +3

Query: 270 EEQTALRLEAQLAPANLLSEILAPVTADMQQMNTNLKNVVGNRHPMLMAAAEQIFGAGGK 449
           ++   L L  +      L  +   V  D+Q++N NL ++VG  +P+L++AAEQIF AGGK
Sbjct: 40  DQTVMLNLRQESRKPISLETLFEVVADDLQRLNDNLLSIVGAENPVLISAAEQIFSAGGK 99

Query: 450 KLRPVIVFLVAHCTAQREGLTELT 521
           ++RP +VFLV+  TA+  GL ELT
Sbjct: 100 RMRPGLVFLVSRATAELAGLKELT 123



EST assemble image


clone accession position
1 MX218g12_r BP090101 1 416
2 HCL007b01_r AV639912 73 509
3 CL07h03_r AV393459 97 623




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research