KCC000164A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000164A_C01 KCC000164A_c01
cttgtcatacgtgaagCAGTAGGTCAACGCGCAGCATTAGAACACGGCATTTGCCCGACG
ACTGCCGGAGTAGCCGGGACTTTTCCTGTTTGACGGGCTTCCTTAGCCATGACCTCTCTG
CTCAAGCAGGTCGCCCTGCCGGTCTTTAACAGCCTGGCGACGACCTACCGGTCCGTCGTT
GGTGCTAAGCTGGCCAAGTATGGCCTGCGCTTCGACGACCTCCAGGACCCCCTGAAGGAC
GAGGACGTGGCGGAGGCCCTGCGCCGCCTGCCTCCCGATGTGGTTGTGGCCCGCAACTGC
CGCCTGCGCCGCGCACTGGACCTGTCTTGCAAGCACGAGGCCCTGCCGAAGGACCTCCTT
GAAAAGCAGACGCCCGAGCTTTCCTACCTGCAGGATGTCCTTAACGAGGTGCGCGCCGAG
CGCCGCGAGCGCGCGCAGCTGGGCGCCCCCGCCCCCTACACCCGCATTTACTACGATTGA
GCGGAGAGGCTTGTGGAGAAGGCGAGCGGCTCTGGAGCTTATGGAGCTACAGGGGTCACG
GCTTATG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000164A_C01 KCC000164A_c01
         (547 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_197927.1| ubiquinol--cytochrome-c reductase-related prote...   111  6e-24
ref|NP_194973.1| ubiquinol-cytochrome c reductase - like protein...   108  4e-23
sp|P48502|UCR6_SOLTU Ubiquinol-cytochrome C reductase complex 14...   102  3e-21
gb|AAP21435.1| putative ubiquinol-cytochrome c reductase [Oryza ...    99  5e-20
ref|NP_849484.1| ubiquinol-cytochrome c reductase - like protein...    97  1e-19

>ref|NP_197927.1| ubiquinol--cytochrome-c reductase-related protein [Arabidopsis
           thaliana]
          Length = 122

 Score =  111 bits (278), Expect = 6e-24
 Identities = 63/119 (52%), Positives = 77/119 (63%)
 Frame = +1

Query: 109 MTSLLKQVALPVFNSLATTYRSVVGAKLAKYGLRFDDLQDPLKDEDVAEALRRLPPDVVV 288
           M S L+++  P  N LA  +   V  +L +YGLR+DDL DPL D D+ EAL RLP ++V 
Sbjct: 1   MASFLQRLVDPRKNFLARMHMKSVSNRLRRYGLRYDDLYDPLYDLDIKEALNRLPREIVD 60

Query: 289 ARNCRLRRALDLSCKHEALPKDLLEKQTPELSYLQDVLNEVRAERRERAQLGAPAPYTR 465
           ARN RL RA+DLS KHE LP +L   QTP  SYLQD+L  V+ ER ER  LGA   Y R
Sbjct: 61  ARNQRLMRAMDLSMKHEYLPDNLQAVQTPFRSYLQDMLALVKRERAEREALGALPLYQR 119

>ref|NP_194973.1| ubiquinol-cytochrome c reductase - like protein [Arabidopsis
           thaliana] gi|7488407|pir||T05357 ubiquinol-cytochrome-c
           reductase (EC 1.10.2.2) 14K chain - Arabidopsis thaliana
           gi|4049349|emb|CAA22574.1| ubiquinol-cytochrome c
           reductase-like protein [Arabidopsis thaliana]
           gi|7270151|emb|CAB79964.1| ubiquinol-cytochrome c
           reductase-like protein [Arabidopsis thaliana]
           gi|11692914|gb|AAG40060.1|AF324709_1 AT4g32470
           [Arabidopsis thaliana]
           gi|11908054|gb|AAG41456.1|AF326874_1 putative
           ubiquinol-cytochrome c reductase [Arabidopsis thaliana]
           gi|12642870|gb|AAK00377.1|AF339695_1 putative
           ubiquinol-cytochrome c reductase [Arabidopsis thaliana]
           gi|13605716|gb|AAK32851.1|AF361839_1 AT4g32470/F8B4_170
           [Arabidopsis thaliana] gi|17978895|gb|AAL47417.1|
           AT4g32470/F8B4_170 [Arabidopsis thaliana]
           gi|21592933|gb|AAM64883.1| ubiquinol-cytochrome c
           reductase-like protein [Arabidopsis thaliana]
          Length = 122

 Score =  108 bits (271), Expect = 4e-23
 Identities = 61/119 (51%), Positives = 73/119 (61%)
 Frame = +1

Query: 109 MTSLLKQVALPVFNSLATTYRSVVGAKLAKYGLRFDDLQDPLKDEDVAEALRRLPPDVVV 288
           M SLLK    P  N LA  +   +  +L +YGLR+DDL D     D+ EA+ RLP +VV 
Sbjct: 1   MASLLKAFIDPKKNFLARMHMKAISTRLRRYGLRYDDLYDQYYSMDIKEAMNRLPREVVD 60

Query: 289 ARNCRLRRALDLSCKHEALPKDLLEKQTPELSYLQDVLNEVRAERRERAQLGAPAPYTR 465
           ARN RL+RA+DLS KHE LPKDL   QTP   YLQD+L  V  E +ER  LGA   Y R
Sbjct: 61  ARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRGYLQDMLALVERESKEREALGALPLYQR 119

>sp|P48502|UCR6_SOLTU Ubiquinol-cytochrome C reductase complex 14 kDa protein (CR14)
           gi|7430484|pir||T07368 ubiquinol-cytochrome-c reductase
           (EC 1.10.2.2) 14K chain - potato
           gi|633681|emb|CAA55863.1| ubiquinol--cytochrome c
           reductase [Solanum tuberosum]
          Length = 123

 Score =  102 bits (255), Expect = 3e-21
 Identities = 56/109 (51%), Positives = 70/109 (63%)
 Frame = +1

Query: 139 PVFNSLATTYRSVVGAKLAKYGLRFDDLQDPLKDEDVAEALRRLPPDVVVARNCRLRRAL 318
           P  N LA  +   + ++L  YGLR DDL DP+ D DV EAL RLP ++V ARN RL RA+
Sbjct: 12  PKKNPLAAIHMKTLSSRLRNYGLRHDDLYDPMYDLDVKEALNRLPREIVDARNQRLLRAM 71

Query: 319 DLSCKHEALPKDLLEKQTPELSYLQDVLNEVRAERRERAQLGAPAPYTR 465
           DLS KH+ LP+DL   QTP  +YLQ++L  V+ E  ER  LGA   Y R
Sbjct: 72  DLSMKHQYLPEDLQAMQTPFRNYLQEMLALVKRESAEREALGALPLYQR 120

>gb|AAP21435.1| putative ubiquinol-cytochrome c reductase [Oryza sativa (japonica
           cultivar-group)]
          Length = 126

 Score = 98.6 bits (244), Expect = 5e-20
 Identities = 51/103 (49%), Positives = 70/103 (67%)
 Frame = +1

Query: 139 PVFNSLATTYRSVVGAKLAKYGLRFDDLQDPLKDEDVAEALRRLPPDVVVARNCRLRRAL 318
           P  N LA  +   + ++L KYGLR+DDL DP  D D+ EAL RLP +VV AR+ RL+RA+
Sbjct: 15  PRRNPLARLHMQAISSRLRKYGLRYDDLYDPKHDLDIKEALERLPREVVDARHQRLKRAM 74

Query: 319 DLSCKHEALPKDLLEKQTPELSYLQDVLNEVRAERRERAQLGA 447
           DLS KH+ L ++   +QTP   YL D+++ V+ ER ER +LGA
Sbjct: 75  DLSMKHQYLSENDQAQQTPFRGYLSDMMDLVKKERLEREELGA 117

>ref|NP_849484.1| ubiquinol-cytochrome c reductase - like protein [Arabidopsis
           thaliana]
          Length = 101

 Score = 97.4 bits (241), Expect = 1e-19
 Identities = 52/98 (53%), Positives = 63/98 (64%)
 Frame = +1

Query: 109 MTSLLKQVALPVFNSLATTYRSVVGAKLAKYGLRFDDLQDPLKDEDVAEALRRLPPDVVV 288
           M SLLK    P  N LA  +   +  +L +YGLR+DDL D     D+ EA+ RLP +VV 
Sbjct: 1   MASLLKAFIDPKKNFLARMHMKAISTRLRRYGLRYDDLYDQYYSMDIKEAMNRLPREVVD 60

Query: 289 ARNCRLRRALDLSCKHEALPKDLLEKQTPELSYLQDVL 402
           ARN RL+RA+DLS KHE LPKDL   QTP   YLQD+L
Sbjct: 61  ARNQRLKRAMDLSMKHEYLPKDLQAVQTPFRGYLQDML 98



EST assemble image


clone accession position
1 CL07g11_r AV393482 1 528
2 MX016d05_r BP086770 17 393
3 LC022c04_r AV620443 20 547
4 MX037e11_r BP087564 23 389




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research