KCC000163A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000163A_C01 KCC000163A_c01
gcgccccccagtccaagtccggccgcggagcttgaacagttccattttccctagcTCTAG
AAGAATGCTGCGGGAGCTCGGACGCACCGCTACCGTTAAGGCCCATGGCCGCAGCGTTCT
GCGCCCCGTGCGCGGGCCGGCTGGCAGGCGCCAGGTGGCGTTCACCGGTGTCCGGCCTTC
GGTCCGTGTGTTCGCTGAGGCGCCCGCTGCCGAGCAGGCCGCCAAGGCTATTAAGCTGGA
GGACGTGAAGGAGGGCTCTGAGTACGAGGGCACCGTGACGACCGTCGAGGAGTTCGGCGC
TTTCGTGAACTTCGGCGCCAACACCAACGGCCTGGTGCACATTTCCAAGCTGGCGTCTGG
GTTCACCAAGAACGCCAAGGACGTGGTTCAGCCTGGCCAGAAGGTGACCGTCAAGGTCCT
GAGCGTGGACGCTGAGAAGAAGCGCGTGTCGCTGGAGCTCAAGTCCGCTGTCGCTGCTGA
GGCGTCGGCTGAGGAGTCGGATGACATTATCACCGAGCCTGACCGCGAGGGCGCTGATGC
CACCGATGACGACGAGGATGTGGAGGTGGAGCTGGAGGACGGCCAGGTGGAGGTCCGCGC
TGACCTGCCCGGCTTTGAGGACATTCCCTTCGTGATGGAGGAGGCGGACATGGACGCCGA
GATGTCGGAGGCGGCCATCGCTGCCCTGGAGGCTGACCTGGACGGTGCCGAGATCCGCTA
CGAGCTGGAGGCCCCCGCCTACATGGAGGAGGTGACCGGCAAGGTGGCCCGCATTGAGGA
CTACGGCGTGTTCCTGGAGTTCGAGTGGAACGGCAAGACCCTGACCGGTCTGCTGGCCAA
GGACGAGATGAAGGTGCCCAGCTCCGCGCTGTCCGCTGAGGCTCAGGCCGCTCTGCGCGC
CGAGTGGGCGGACACCGGCTTTGAGATGCCCGCCTTCGTGGAGCTGCCCGATGACGAGCT
GGACGTCAAGAAGTACTACCAGCCCGGCGAGTCGGTGCCCGCTTTCGTGCTGGAGTCGAG
CCTGGTTGACGGCCGCGGCATTAGCCTGACCCACTTCACTGACGAGGAGGTGTCGGCTGA
GGCTGTTGCTGCCTACGAGGAGCTGGAGGACGACGAGGACGAGGAGCT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000163A_C01 KCC000163A_c01
         (1128 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAO50865.1| similar to Leishmania major. Ppg3 [Dictyostelium ...   105  1e-21
gb|AAK31375.1|AC084329_1 ppg3 [Leishmania major]                      105  1e-21
ref|NP_492875.2| pre-mRNA splicing SR protein related (68.2 kD) ...   100  4e-20
ref|NP_346206.1| cell wall surface anchor family protein [Strept...   100  8e-20
gb|AAK95470.1| LF3 [cercopithicine herpesvirus 15]                     98  2e-19

>gb|AAO50865.1| similar to Leishmania major. Ppg3 [Dictyostelium discoideum]
          Length = 374

 Score =  105 bits (262), Expect = 1e-21
 Identities = 94/318 (29%), Positives = 172/318 (53%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            SSSSSSSSSSS ++++S+ +SSS          S+   SS+ + + S       +SSSSS
Sbjct: 67   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 126

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             SS+ +  S   S+ S+  ++ +S+ S+   +  SS +S         S+S ++  SS  
Sbjct: 127  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 186

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            ++   +SS  + +SSS   S+ S S+S ++ ++S  S+S S+SS +   SS    S+ +S
Sbjct: 187  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 246

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSASTLRTLT 409
            +  SSSS+S+SSSSS +S+ S S S   SS SS+ +S++++  SSS +   S+S+     
Sbjct: 247  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS----- 301

Query: 408  VTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSLI 229
                   ++S +   +  +S    +     +   + + +SS+  +  S S  S +SSS  
Sbjct: 302  -------SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 354

Query: 228  ALAACSAAGASANTRTEG 175
            + ++ S++ +S+++ + G
Sbjct: 355  SSSSSSSSSSSSSSSSSG 372

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 92/314 (29%), Positives = 170/314 (53%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            SSSSSSSSSSS ++++S+ +SSS               SS+ + + S        SSSSS
Sbjct: 66   SSSSSSSSSSSSSSSSSSSSSSS---------------SSSSSSSSS--------SSSSS 102

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             SS+ +  S   S+ S+  ++ +S+ S+   +  SS +S         S+S ++  SS  
Sbjct: 103  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS---------SSSSSSSSSSSS 153

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            ++   +SS  + +SSS   S+ S S+S ++ ++S  S+S S+SS +   SS    S+ +S
Sbjct: 154  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 213

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSASTLRTLT 409
            +  SSSS+S+SSSSS +S+ S S S   SS SS+ +S++++  SSS +   S+S+  + +
Sbjct: 214  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 273

Query: 408  VTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSLI 229
             +     ++S +   +  +S    +     +   + + +SS+  +  S S  S +SSS  
Sbjct: 274  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 333

Query: 228  ALAACSAAGASANT 187
            + ++ S++ +S+++
Sbjct: 334  SSSSSSSSSSSSSS 347

 Score = 87.0 bits (214), Expect = 5e-16
 Identities = 75/222 (33%), Positives = 126/222 (55%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            SSSSSSSSSSS ++++S+ +SSS               SS+ + + S       +SSSSS
Sbjct: 182  SSSSSSSSSSSSSSSSSSSSSSS--------------SSSSSSSSSS-------SSSSSS 220

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             SS+ +  S   S+ S+  ++ +S+ S+   +  SS +S         S+S ++  SS  
Sbjct: 221  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS---------SSSSSSSSSSSS 271

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            ++   +SS  + +SSS   S+ S S+S ++ ++S  S+S S+SS +   SS    S+ +S
Sbjct: 272  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 331

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAATAD 463
            +  SSSS+S+SSSSS +S+ S S S   SS SS+ +S+++ +
Sbjct: 332  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGE 373

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 75/260 (28%), Positives = 144/260 (54%)
 Frame = -1

Query: 966 TSSSSSGSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNT 787
           TSSSSS SS+ +  S   S+ S+  ++ +S+ S+   +  SS +S         S+S ++
Sbjct: 65  TSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 124

Query: 786 P*SSMRATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPG 607
             SS  ++   +SS  + +SSS   S+ S S+S ++ ++S  S+S S+SS +   SS   
Sbjct: 125 SSSSSSSSSSSSSSSSSSSSSS--SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 182

Query: 606 RSARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSAS 427
            S+ +S+  SSSS+S+SSSSS +S+ S S S   SS SS+ +S++++  SSS +   S+S
Sbjct: 183 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 242

Query: 426 TLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSF 247
           +  + + +     ++S +   +  +S    +     +   + + +SS+  +  S S  S 
Sbjct: 243 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 302

Query: 246 TSSSLIALAACSAAGASANT 187
           +SSS  + ++ S++ +S+++
Sbjct: 303 SSSSSSSSSSSSSSSSSSSS 322

 Score = 73.6 bits (179), Expect = 6e-12
 Identities = 60/213 (28%), Positives = 120/213 (56%)
 Frame = -1

Query: 825 VRVLPFHSNSRNTP*SSMRATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMS 646
           + +L   S+S ++  SS  ++   +SS  + +SSS   S+ S S+S ++ ++S  S+S S
Sbjct: 60  LNILDTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 119

Query: 645 ASSITKGMSSKPGRSARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAATA 466
           +SS +   SS    S+ +S+  SSSS+S+SSSSS +S+ S S S   SS SS+ +S++++
Sbjct: 120 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 179

Query: 465 DLSSSDTRFFSASTLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSS 286
             SSS +   S+S+  + + +     ++S +   +  +S    +     +   + + +SS
Sbjct: 180 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 239

Query: 285 TVVTVPSYSEPSFTSSSLIALAACSAAGASANT 187
           +  +  S S  S +SSS  + ++ S++ +S+++
Sbjct: 240 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 272

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 52/183 (28%), Positives = 102/183 (55%)
 Frame = -1

Query: 735 GASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTSTWPSSSSTSTS 556
           G +S   I   S S+S ++ ++S  S+S S+SS +   SS    S+ +S+  SSSS+S+S
Sbjct: 55  GVASFLNILDTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 114

Query: 555 SSSSVASAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSASTLRTLTVTFWPG*TTSL 376
           SSSS +S+ S S S   SS SS+ +S++++  SSS +   S+S+  + + +     ++S 
Sbjct: 115 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 174

Query: 375 AFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSLIALAACSAAGAS 196
           +   +  +S    +     +   + + +SS+  +  S S  S +SSS  + ++ S++ +S
Sbjct: 175 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 234

Query: 195 ANT 187
           +++
Sbjct: 235 SSS 237

 Score = 50.8 bits (120), Expect = 4e-05
 Identities = 41/160 (25%), Positives = 86/160 (53%)
 Frame = -1

Query: 666 DISASMSASSITKGMSSKPGRSARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSA 487
           D+  +   + +    SS    S+ +S+  SSSS+S+SSSSS +S+ S S S   SS SS+
Sbjct: 53  DLGVASFLNILDTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 112

Query: 486 DASAATADLSSSDTRFFSASTLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKF 307
            +S++++  SSS +   S+S+  + + +     ++S +   +  +S    +     +   
Sbjct: 113 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 172

Query: 306 TKAPNSSTVVTVPSYSEPSFTSSSLIALAACSAAGASANT 187
           + + +SS+  +  S S  S +SSS  + ++ S++ +S+++
Sbjct: 173 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 212

>gb|AAK31375.1|AC084329_1 ppg3 [Leishmania major]
          Length = 1325

 Score =  105 bits (262), Expect = 1e-21
 Identities = 106/314 (33%), Positives = 168/314 (52%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            SS+SSSSSS+  A+++SA +SSS         PS    S+  + + +P        S+SS
Sbjct: 676  SSASSSSSSAPSASSSSAPSSSS-------SAPSASSSSAPSSSSSAP--------SASS 720

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             S+  +  S P ++ S+  ++ +SA SA   +  SS +S P       S S ++  SS  
Sbjct: 721  SSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAP-------SASSSSAPSSSS 773

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            ++ P  SS  A +SSS   SAPS S+S A  ++S  + S S+SS     SS P  SA +S
Sbjct: 774  SSAPSASSSSAPSSSS---SAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAP--SASSS 828

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSASTLRTLT 409
            + PSSSS++ S+SSS  SAPS S S   +S SSA +S+++A  +SS +   S+S+  + +
Sbjct: 829  SAPSSSSSAPSASSS--SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSAS 886

Query: 408  VTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSLI 229
             +  P  ++S A    P AS          +     + +SS+  +  S S PS +SSS  
Sbjct: 887  SSSAPSSSSSSA----PSASSSSAPSS---SSSSAPSASSSSAPSSSSSSAPSASSSSAP 939

Query: 228  ALAACSAAGASANT 187
            + ++ SA  AS+++
Sbjct: 940  SSSSSSAPSASSSS 953

 Score =  102 bits (255), Expect = 9e-21
 Identities = 106/322 (32%), Positives = 167/322 (50%), Gaps = 8/322 (2%)
 Frame = -1

Query: 1128 SSSSSSSSSSS----*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTS 961
            SSSS+ SSSSS     +++A + +SSS         PS+   + + + + +P        
Sbjct: 749  SSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAP 808

Query: 960  SSSSGSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP* 781
            S+SS S+  +  S P ++ S+  ++ +SA SA   +  SS +S P        +S ++  
Sbjct: 809  SASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAP 868

Query: 780  SSMRATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRS 601
            S+  ++ P +SS    ASSS   SAPS S+S +A +AS  SA  S+SS     SS    S
Sbjct: 869  SASSSSAPSSSSSAPSASSS---SAPS-SSSSSAPSASSSSAPSSSSSSAPSASSSSAPS 924

Query: 600  ARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSA-DASAATADLSSSDTRFFSAST 424
            + +S+ PS+SS+S  SSSS +SAPS S S   SS SSA  AS+++A  SSS     S+S+
Sbjct: 925  SSSSSAPSASSSSAPSSSS-SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSS 983

Query: 423  LRTLTVTFWPG*TTSLAFLVN---PDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEP 253
              + + +  P  ++S A   +   P AS          AP  + +   S+  + PS S  
Sbjct: 984  APSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS 1043

Query: 252  SFTSSSLIALAACSAAGASANT 187
            S  SSS  A +A S++  S+++
Sbjct: 1044 SAPSSSSSAPSASSSSAPSSSS 1065

 Score =  100 bits (249), Expect = 5e-20
 Identities = 107/316 (33%), Positives = 167/316 (51%), Gaps = 2/316 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+ SSSSSS+  A+++SA +SSS         PS    S+  + + +P        SSSS
Sbjct: 798  SAPSSSSSSAPSASSSSAPSSSS-------SAPSASSSSAPSSSSSAPSASSSSAPSSSS 850

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFH-SNSRNTP*SSM 772
             + + +  S P S+ SA  A+ +SA S+      +S +S P        S S ++  SS 
Sbjct: 851  SAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS 910

Query: 771  RATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSART 592
             ++ P  SS  A +SSS   SAPS S+S A  ++S  + S S+SS     SS P  SA +
Sbjct: 911  SSSAPSASSSSAPSSSS--SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAP--SASS 966

Query: 591  STWPSSSSTSTSSSSSVASAPSRSGSVIMS-SDSSADASAATADLSSSDTRFFSASTLRT 415
            S+ PSSSS++ S+SSS  SAPS S S   S S SSA +S+++A  +SS +   S+S+  +
Sbjct: 967  SSAPSSSSSAPSASSS--SAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPS 1024

Query: 414  LTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSS 235
             + +  P  ++S     +  A     + P   +   + AP+SS+  + PS S  S  SSS
Sbjct: 1025 ASSSSAPSSSSSAPSASSSSAPSSSSSAP---SASSSSAPSSSS-SSAPSASSSSAPSSS 1080

Query: 234  LIALAACSAAGASANT 187
              A +A S++  S+++
Sbjct: 1081 SSAPSASSSSAPSSSS 1096

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 103/314 (32%), Positives = 163/314 (51%), Gaps = 1/314 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            SS+ SSSSS+  A+++SA +SSS         PS    S+  + + +P        SSSS
Sbjct: 782  SSAPSSSSSAPSASSSSAPSSSSSS------APSASSSSAPSSSSSAPSASSSSAPSSSS 835

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             + + +  S P S+ SA  A+ +SA S+      +S +S P       S S ++  SS  
Sbjct: 836  SAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSS 895

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            ++ P  SS  A +SSS   SAPS S+S A  ++S  + S S+SS     SS    SA +S
Sbjct: 896  SSAPSASSSSAPSSSS--SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSS-APSASSS 952

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSA-DASAATADLSSSDTRFFSASTLRTL 412
            + PSSSS S  S+SS +SAPS S S   +S SSA  +S+++A  +SS +   S+S+  + 
Sbjct: 953  SAPSSSS-SAPSASS-SSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSA 1010

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            + +  P  ++S     +  A     + P   A   +   +SS+  +  S S PS +SSS 
Sbjct: 1011 SSSSAPSSSSSAPSASSSSAPSSSSSAP--SASSSSAPSSSSSAPSASSSSAPSSSSSSA 1068

Query: 231  IALAACSAAGASAN 190
             + ++ SA  +S++
Sbjct: 1069 PSASSSSAPSSSSS 1082

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 96/315 (30%), Positives = 159/315 (50%), Gaps = 1/315 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+ SSSSS+ S +++++  +SSS         PS+   + + + + +P        S+SS
Sbjct: 722  SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASS 781

Query: 948  GSSTKAGISKP-VSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSM 772
             S+  +  S P  S+ SA  ++ +SA SA   +  SS +S P       ++S + P SS 
Sbjct: 782  SSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAP------SASSSSAPSSSS 835

Query: 771  RATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSART 592
             A  P  SS  A +SSS   SAPS S+S A  ++S  + S S+SS     SS P  S+ +
Sbjct: 836  SA--PSASSSSAPSSSS---SAPSASSSSAPSSSSS-APSASSSSAPSSSSSAPSASSSS 889

Query: 591  STWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSASTLRTL 412
            +   SSSS  ++SSSS  S+ S S     SS + + +S++    SSS     S+S+  + 
Sbjct: 890  APSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSA 949

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            + +  P  ++S     +  A     + P   +   + AP+SS+  + PS S  S  SSS 
Sbjct: 950  SSSSAPSSSSSAPSASSSSAPSSSSSAP---SASSSSAPSSSS-SSAPSASSSSAPSSSS 1005

Query: 231  IALAACSAAGASANT 187
             A +A S++  S+++
Sbjct: 1006 SAPSASSSSAPSSSS 1020

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 89/240 (37%), Positives = 125/240 (52%), Gaps = 6/240 (2%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            +SSSS+ SSSS A +AS+ ++ S          S+   SS+ +   S       +SSSSS
Sbjct: 870  ASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSS 929

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
              S  +  +   S+ SA  A+ +SA S+      +S +S P       S S ++  SS  
Sbjct: 930  APSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSS 989

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            ++ P  SS  A +SSS   SAPS S+S    A S  S++ SASS +   SS    SA +S
Sbjct: 990  SSAPSASSSSAPSSSS---SAPSASSS---SAPSSSSSAPSASSSSAPSSSSSAPSASSS 1043

Query: 588  TWPSSSSTSTSSSSSVA------SAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSAS 427
            + PSSSS++ S+SSS A      SAPS S S   SS SSA  SA+++   SS + F S S
Sbjct: 1044 SAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSA-PSASSSSAPSSSSSFLSGS 1102

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 83/246 (33%), Positives = 132/246 (52%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            SS+ SSSSS+  A+++SA +SSS         PS    S+  + + S       ++SSSS
Sbjct: 873  SSAPSSSSSAPSASSSSAPSSSSSS------APSASSSSAPSSSSSSAP-----SASSSS 921

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
              S+ +  +   S+ SA  ++ +SA SA   +  SS +S P        +S ++  S+  
Sbjct: 922  APSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASS 981

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            ++ P +SS  A ++SS   SAPS S+S A  A+S  + S S+S+ +   SS P  S   S
Sbjct: 982  SSAPSSSSSSAPSASS--SSAPSSSSS-APSASSSSAPSSSSSAPSASSSSAPSSS---S 1035

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSASTLRTLT 409
            + PS+SS+S  SSSS A + S S +   SS S+  AS+++A  SSS     S+S+  + +
Sbjct: 1036 SAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 1095

Query: 408  VTFWPG 391
             +F  G
Sbjct: 1096 SSFLSG 1101

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 86/252 (34%), Positives = 133/252 (52%), Gaps = 1/252 (0%)
 Frame = -1

Query: 939  TKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMRATL 760
            T++  S P ++ S+  ++ +SA SA   +  SS +S P       ++S + P SS  A  
Sbjct: 664  TESSSSAPSASSSSASSSSSSAPSASSSSAPSSSSSAP------SASSSSAPSSSSSA-- 715

Query: 759  PVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTSTWP 580
            P  SS  A +SSS   SAPS S+S A    S  S++ SASS +   SS    SA +S+ P
Sbjct: 716  PSASSSSAPSSSS---SAPSASSSSAP---SSSSSAPSASSSSAPSSSSSAPSASSSSAP 769

Query: 579  SSSSTSTSSSSSVASAPSRSGSVIMSSDSSA-DASAATADLSSSDTRFFSASTLRTLTVT 403
            SSSS+S  S+SS +SAPS S S   +S SSA  +S+++A  +SS +   S+S+  + + +
Sbjct: 770  SSSSSSAPSASS-SSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSS 828

Query: 402  FWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSLIAL 223
              P  ++S      P AS          AP  + +   S+  + PS S  S  SSS  A 
Sbjct: 829  SAPSSSSSA-----PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAP 883

Query: 222  AACSAAGASANT 187
            +A S++  S+++
Sbjct: 884  SASSSSAPSSSS 895

 Score = 73.2 bits (178), Expect = 8e-12
 Identities = 69/204 (33%), Positives = 105/204 (50%), Gaps = 1/204 (0%)
 Frame = -1

Query: 1125 SSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDS-PGW*YFLTSSSSS 949
            SSSSSS+ S+ +++A + +SSS         PS+   S+  A + S P       S+SSS
Sbjct: 908  SSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSS 967

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             + + +  +   S+ SA  ++ +SA SA   +  SS +S P        +S ++  S+  
Sbjct: 968  SAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASS 1027

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            ++ P +SS    ASSS   SAPS S+S  A +AS  SA  S+SS     SS    S+ +S
Sbjct: 1028 SSAPSSSSSAPSASSS---SAPSSSSS--APSASSSSAPSSSSSSAPSASSSSAPSSSSS 1082

Query: 588  TWPSSSSTSTSSSSSVASAPSRSG 517
               +SSS++ SSSSS  S     G
Sbjct: 1083 APSASSSSAPSSSSSFLSGSGSDG 1106

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 70/195 (35%), Positives = 103/195 (51%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            SSSS+ SSSSS A +AS+ ++ S         PS    S+  + + +P       S+SSS
Sbjct: 934  SSSSAPSSSSSSAPSASSSSAPSSS----SSAPSASSSSAPSSSSSAP-------SASSS 982

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             + + +  S P ++ S+  ++ +SA SA   +  SS +S P       ++S + P SS  
Sbjct: 983  SAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAP------SASSSSAPSSSSS 1036

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            A  P  SS  A +SSS   SAPS S+S A  ++S  + S S+SS     SS P  SA +S
Sbjct: 1037 A--PSASSSSAPSSSS---SAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAP--SASSS 1089

Query: 588  TWPSSSSTSTSSSSS 544
            + PSSSS+  S S S
Sbjct: 1090 SAPSSSSSFLSGSGS 1104

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 73/211 (34%), Positives = 109/211 (51%), Gaps = 11/211 (5%)
 Frame = -1

Query: 786  P*SSMRATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPG 607
            P +   ++ P  SS  A +SSS   SAPS S+S A    S  S++ SASS +   SS   
Sbjct: 662  PETESSSSAPSASSSSASSSSS---SAPSASSSSAP---SSSSSAPSASSSSAPSSSSSA 715

Query: 606  RSARTSTWPSSSST------STSSSSSVASAPSRSGSVIMSSDSSA-DASAATADLSSSD 448
             SA +S+ PSSSS+      S++ SSS +SAPS S S   SS SSA  AS+++A  SSS 
Sbjct: 716  PSASSSSAPSSSSSAPSASSSSAPSSS-SSAPSASSSSAPSSSSSAPSASSSSAPSSSSS 774

Query: 447  TRFFSASTLRTLTVTFWPG*TTSLAFLVN----PDASLEMCTRPLVLAPKFTKAPNSSTV 280
            +   ++S+    + +  P  ++S A   +    P AS          AP  + +   S+ 
Sbjct: 775  SAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 834

Query: 279  VTVPSYSEPSFTSSSLIALAACSAAGASANT 187
             + PS S  S  SSS  A +A S++  S+++
Sbjct: 835  SSAPSASSSSAPSSSSSAPSASSSSAPSSSS 865

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 58/185 (31%), Positives = 94/185 (50%), Gaps = 13/185 (7%)
 Frame = -1

Query: 702  SRSASRAAMAASDISASMSASSITKGMSSKPGRSARTSTWPSSSSTSTSSSS-------- 547
            + +A +    +S  + S S+SS +   SS P  S+ ++   SSS+ S SSSS        
Sbjct: 656  TENACKPETESSSSAPSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSA 715

Query: 546  ---SVASAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSASTLRTLTVTFWPG*TTSL 376
               S +SAPS S S   +S SSA +S+++A  +SS +   S+S+  + + +  P  ++S 
Sbjct: 716  PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSS 775

Query: 375  AFLVNPDASLEMCTRPLVLAP--KFTKAPNSSTVVTVPSYSEPSFTSSSLIALAACSAAG 202
            A    P AS          AP    + AP+SS+  + PS S  S  SSS  A +A S++ 
Sbjct: 776  A----PSASSSSAPSSSSSAPSASSSSAPSSSS-SSAPSASSSSAPSSSSSAPSASSSSA 830

Query: 201  ASANT 187
             S+++
Sbjct: 831  PSSSS 835

 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 53/164 (32%), Positives = 89/164 (53%)
 Frame = -1

Query: 678  MAASDISASMSASSITKGMSSKPGRSARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSS 499
            + ASD +   +    T+  SS P  SA +S+  SSSS++ S+SSS  SAPS S S   +S
Sbjct: 649  LLASDCATENACKPETESSSSAP--SASSSSASSSSSSAPSASSS--SAPSSSSSAPSAS 704

Query: 498  DSSADASAATADLSSSDTRFFSASTLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVL 319
             SSA +S+++A  +SS +   S+S+  + + +  P  ++S     +  A     + P   
Sbjct: 705  SSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAP--- 761

Query: 318  APKFTKAPNSSTVVTVPSYSEPSFTSSSLIALAACSAAGASANT 187
            +   + AP+SS+  + PS S  S  SSS  A +A S++  S+++
Sbjct: 762  SASSSSAPSSSS-SSAPSASSSSAPSSSSSAPSASSSSAPSSSS 804

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 51/176 (28%), Positives = 88/176 (49%), Gaps = 4/176 (2%)
 Frame = -1

Query: 705  PSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTSTWPSSSSTSTSSSS----SVA 538
            P   AS  A   +    + S+SS     SS    S+ ++   SSSS  +SSSS    S +
Sbjct: 647  PELLASDCATENACKPETESSSSAPSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSS 706

Query: 537  SAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSASTLRTLTVTFWPG*TTSLAFLVNP 358
            SAPS S S   +S SSA +S+++A  +SS +   S+S+  + + +  P  ++S A   + 
Sbjct: 707  SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS-SSSSAPSASS 765

Query: 357  DASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSLIALAACSAAGASAN 190
             ++    +     A   +   +SS+  +  S S PS +SSS  + ++ SA  +S++
Sbjct: 766  SSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 821

>ref|NP_492875.2| pre-mRNA splicing SR protein related (68.2 kD) (rsr-1)
            [Caenorhabditis elegans] gi|19571645|emb|CAB04214.3| C.
            elegans RSR-1 protein (corresponding sequence F28D9.1)
            [Caenorhabditis elegans]
          Length = 601

 Score =  100 bits (250), Expect = 4e-20
 Identities = 108/370 (29%), Positives = 150/370 (40%), Gaps = 54/370 (14%)
 Frame = -2

Query: 1100 PRRQQQPQPTPPRQ*S------GSG*CRGRQPGSTPARKRAPTRRAGSTS*RPAR--HRA 945
            P R   P+ TPPR+ +      G G    R+ GS   R+R+P RR       P R   R+
Sbjct: 175  PARALSPRKTPPRRNASPGGDGGGGSPAARRGGSAGNRRRSPPRRGSPRRGSPRRDTRRS 234

Query: 944  APRRRASQSRCPPTR------RAERPEPQRTARSWAPSSRPWPADR-------------- 825
             PRRR S    PP R      R E   P R  +     SR    +R              
Sbjct: 235  PPRRRGS----PPARGGDRRDRREDRRPVRDEKEREEESRRREIERKKRHEEAELRQKAI 290

Query: 824  --------SGSCRSTRTPGTRRSPQCGPPCRSPPPCRRGPPARSGSRHRPGQPPGQRWPP 669
                    SGS R  R+P   +SP      RSP   +   P R+ SR +    P +R   
Sbjct: 291  ASVAARAKSGSPRRRRSPSASKSPPPARRRRSPSQSKSPAPKRAKSRSKSPPAPARRRRS 350

Query: 668  PTSRRPCPPPPSRRECPQSRAGQRGPPPGRPPAP-----PPHPRRHRWHQRPRGQAR**C 504
            P++ +  PP P R     +++  + PP  R  +P     PP PRR R   + R  A    
Sbjct: 351  PSASKSPPPAPKR-----AKSRSKSPPARRRRSPSASKSPPAPRRRRSPSKSRSPA---- 401

Query: 503  HPTPQPTPQQRQRT*APATRASSQRPRSGP*RSPSGQAEPRPWRSW*TQTPAWKCAPGRW 324
             P  +  P +R+R  +P+   S   P+    RS S  A PR  RS     P+   +P   
Sbjct: 402  -PKREIPPARRRR--SPSASKSPPAPKRAKSRSKSPPA-PRRRRS-----PSQSKSP--- 449

Query: 323  CWRRSSRKRRTPRRSSRCPRTQSPPS----------RPPA**PWR---PARQRAPQRTHG 183
                + R+RR+P +S + PR +  PS          R PA  P R   P R+R+P+R   
Sbjct: 450  ----APRRRRSPSKSPQAPRRRRSPSGSKSRSPRRRRSPAAAPRRRQSPQRRRSPRRRRS 505

Query: 182  PKAGHR*TPP 153
            P +  R   P
Sbjct: 506  PSSSSRSRSP 515

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 111/371 (29%), Positives = 154/371 (40%), Gaps = 52/371 (14%)
 Frame = -2

Query: 1121 RPRRPP---APRR---QQQPQPTPPRQ*SGSG*CRG---------RQPGSTPARKRAPTR 987
            R R PP   +PRR   ++  + +PPR+  GS   RG         R+P      +   +R
Sbjct: 212  RRRSPPRRGSPRRGSPRRDTRRSPPRR-RGSPPARGGDRRDRREDRRPVRDEKEREEESR 270

Query: 986  RAGSTS*RPARHRAAPRRRAS--------QSRCPPTRRA----ERPEPQRTARSWAPSSR 843
            R      R  RH  A  R+ +        +S  P  RR+    + P P R  RS + S  
Sbjct: 271  RREIE--RKKRHEEAELRQKAIASVAARAKSGSPRRRRSPSASKSPPPARRRRSPSQSKS 328

Query: 842  PWPADRSGSCRSTRTPGTRRSPQCGPPCRSPPPCRRGPPARSGSRHRPGQPPGQRWPPPT 663
            P P       +S   P  RR        RSP   +  PPA   ++ R   PP +R   P+
Sbjct: 329  PAPKRAKSRSKSPPAPARRR--------RSPSASKSPPPAPKRAKSRSKSPPARRRRSPS 380

Query: 662  SRRPCPPPPSRRECP---QSRAGQRGPPPGR----------PPAP---------PPHPRR 549
            + +  PP P RR  P   +S A +R  PP R          PPAP         PP PRR
Sbjct: 381  ASK-SPPAPRRRRSPSKSRSPAPKREIPPARRRRSPSASKSPPAPKRAKSRSKSPPAPRR 439

Query: 548  HRWHQRPRGQAR**CHPTPQPTPQQRQRT*APATRASSQRPRSGP*RSPSGQAEPRPWRS 369
             R              P+   +P  R+R  +P+    + R R    RSPSG     P R 
Sbjct: 440  RR-------------SPSQSKSPAPRRRR-SPSKSPQAPRRR----RSPSGSKSRSPRR- 480

Query: 368  W*TQTPAWKCAPGRWCWRRSSRKRRTPRR---SSRCPRTQSPPSRPPA**PWRPARQRAP 198
               ++PA   AP R   R+S ++RR+PRR    S   R++SPP  PP   P + + Q+AP
Sbjct: 481  --RRSPA--AAPRR---RQSPQRRRSPRRRRSPSSSSRSRSPP--PPPRRPRQDSEQQAP 531

Query: 197  QRTHGPKAGHR 165
                 P+   R
Sbjct: 532  VAVKSPEMKKR 542

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 73/237 (30%), Positives = 99/237 (40%), Gaps = 16/237 (6%)
 Frame = -2

Query: 1127 APRPRRPPAPRRQQQPQPTPPRQ*SGSG*CRGRQPGSTPARKRAPTRRAGSTS*RPARHR 948
            +P   + PAP+R +    +PP         R R P ++ +   AP R    +   PAR R
Sbjct: 322  SPSQSKSPAPKRAKSRSKSPPAPAR-----RRRSPSASKSPPPAPKRAKSRSKSPPARRR 376

Query: 947  AAP-----------RRRASQSRCPPTRRAERPEPQRTARSWAPSSRPWPADRSGSCRSTR 801
             +P           RR  S+SR P  +R E P  +R     A  S P P       +S  
Sbjct: 377  RSPSASKSPPAPRRRRSPSKSRSPAPKR-EIPPARRRRSPSASKSPPAPKRAKSRSKSPP 435

Query: 800  TPGTRRSPQCGPPCRSPPPCRRGPPARS-GSRHRPGQPPGQRWPPPTSRRPCPPPPSRRE 624
             P  RRSP      +SP P RR  P++S  +  R   P G +   P  RR     P RR+
Sbjct: 436  APRRRRSPS---QSKSPAPRRRRSPSKSPQAPRRRRSPSGSKSRSPRRRRSPAAAPRRRQ 492

Query: 623  CPQSRAG---QRGP-PPGRPPAPPPHPRRHRWHQRPRGQAR**CHPTPQPTPQQRQR 465
             PQ R     +R P    R  +PPP PRR R  Q    QA     P    +P+ ++R
Sbjct: 493  SPQRRRSPRRRRSPSSSSRSRSPPPPPRRPR--QDSEQQA-----PVAVKSPEMKKR 542

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 78/276 (28%), Positives = 102/276 (36%), Gaps = 33/276 (11%)
 Frame = -2

Query: 827 RSGSCRSTRTPGTRRSPQCGPPCRSPPPCRRGPPARSGSRHRPGQPPGQRWPPP---TSR 657
           R  + R  R P    SP+  PP R+  P   G      +R R G    +R  PP   + R
Sbjct: 165 REKAVRDDRIPARALSPRKTPPRRNASPGGDGGGGSPAAR-RGGSAGNRRRSPPRRGSPR 223

Query: 656 RPCP------PPPSRRECPQSRAGQRGPPPGRPPAPPPHPRRHRWHQRPRGQAR**CHPT 495
           R  P       PP RR  P +R G R     R       P R    +    + R      
Sbjct: 224 RGSPRRDTRRSPPRRRGSPPARGGDR-----RDRREDRRPVRDEKEREEESRRREIERKK 278

Query: 494 PQPTPQQRQRT*AP-ATRASSQRPRSGP*RSPSGQAEPRPWRSW*TQTPAWKCAPGRWCW 318
                + RQ+  A  A RA S  PR    RSPS    P P R   + + +   AP R   
Sbjct: 279 RHEEAELRQKAIASVAARAKSGSPRRR--RSPSASKSPPPARRRRSPSQSKSPAPKRAKS 336

Query: 317 RRSS-----RKRRTPRRSSRCP--------RTQSPPSR----------PPA**PWRPARQ 207
           R  S     R+RR+P  S   P        R++SPP+R          PPA     P R+
Sbjct: 337 RSKSPPAPARRRRSPSASKSPPPAPKRAKSRSKSPPARRRRSPSASKSPPA-----PRRR 391

Query: 206 RAPQRTHGPKAGHR*TPPGACQPARARGAERCGHGP 99
           R+P ++  P       P     PAR R +      P
Sbjct: 392 RSPSKSRSP------APKREIPPARRRRSPSASKSP 421

>ref|NP_346206.1| cell wall surface anchor family protein [Streptococcus pneumoniae
            TIGR4] gi|25389341|pir||E95206 cell wall surface anchor
            family protein [imported] - Streptococcus pneumoniae
            (strain TIGR4) gi|14973269|gb|AAK75846.1| cell wall
            surface anchor family protein [Streptococcus pneumoniae
            TIGR4]
          Length = 4776

 Score = 99.8 bits (247), Expect = 8e-20
 Identities = 98/326 (30%), Positives = 168/326 (51%), Gaps = 1/326 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S  + +S  A T +       ++S+S+
Sbjct: 4000 SASTSASASASTSASASASTSASAS-ASTSASASASISASESASTSA-------SASAST 4051

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S+ AS         S S +T  +S  
Sbjct: 4052 SASASASTSASASASTSASASASTSASASASTSASASASTSA------SASASTS-ASAS 4104

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            A+   ++S    AS S   SA S SAS +A A++ ISAS SAS+     +S    ++ ++
Sbjct: 4105 ASTSASASASTSASESASTSA-SASASTSASASASISASESASTSASASASTSASASAST 4163

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRTL 412
            +  +S+STS S S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  + 
Sbjct: 4164 SASASASTSASESASTSTSASASTSASESASTSASASASTSASASASTSASASASTSASA 4223

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            + +     +TS +   +  AS    T     A     A ++ST  +  + +  S ++S+ 
Sbjct: 4224 SASTSASASTSASESASTSASASASTSASASASTSASA-SASTSASASASTSASASASTS 4282

Query: 231  IALAACSAAGASANTRTEGRTPVNAT 154
             + +A ++A ASA+T        +A+
Sbjct: 4283 ASASASTSASASASTSASASASTSAS 4308

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 98/331 (29%), Positives = 163/331 (48%), Gaps = 6/331 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKW-VRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSS 952
            S+S+S+S+S+S +A+ASA TS+S    +      ST    S    T +       ++S S
Sbjct: 528  SASTSTSASASTSASASASTSASASASISASESASTSASESASTSTSASA---STSASES 584

Query: 951  SGSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSM 772
            + +S  A  S   SA ++  A+ +++ SA   T  S  AS         S S +   +S 
Sbjct: 585  ASTSASASASTSASASASTSASASASTSASASTSASESASTSASASASTSASAS---AST 641

Query: 771  RATLPVTSSM*AGASSS*RISAP---SRSASRAAMAASDISASMSASSITKGMSSKPGRS 601
             A+   ++S  A AS+S  +SA    S SAS +A A++  SAS SAS+     +S    +
Sbjct: 642  SASASASTSASASASTSASVSASTSASASASTSASASASTSASESASTSASASASTSASA 701

Query: 600  ARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSAST 424
            + +++  +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST
Sbjct: 702  SASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAST 761

Query: 423  LRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFT 244
              + + +     + S++   +   S          A   T A  S++     S S  +  
Sbjct: 762  SASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASESASTSASA 821

Query: 243  SSSLIALAACS-AAGASANTRTEGRTPVNAT 154
            S+S  A A+ S +A ASA+T        +A+
Sbjct: 822  SASTSASASASTSASASASTSASASASTSAS 852

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 98/331 (29%), Positives = 163/331 (48%), Gaps = 6/331 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKW-VRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSS 952
            S+S+S+S+S+S +A+ASA TS+S    +      ST    S    T +       ++S S
Sbjct: 3014 SASTSTSASASTSASASASTSASASASISASESASTSASESASTSTSASA---STSASES 3070

Query: 951  SGSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSM 772
            + +S  A  S   SA ++  A+ +++ SA   T  S  AS         S S +   +S 
Sbjct: 3071 ASTSASASASTSASASASTSASASASTSASASTSASESASTSASASASTSASAS---AST 3127

Query: 771  RATLPVTSSM*AGASSS*RISAP---SRSASRAAMAASDISASMSASSITKGMSSKPGRS 601
             A+   ++S  A AS+S  +SA    S SAS +A A++  SAS SAS+     +S    +
Sbjct: 3128 SASASASTSASASASTSASVSASTSASASASTSASASASTSASESASTSASASASTSASA 3187

Query: 600  ARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSAST 424
            + +++  +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST
Sbjct: 3188 SASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASAST 3247

Query: 423  LRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFT 244
              + + +     + S++   +   S          A   T A  S++     S S  +  
Sbjct: 3248 SASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASESASTSASA 3307

Query: 243  SSSLIALAACS-AAGASANTRTEGRTPVNAT 154
            S+S  A A+ S +A ASA+T        +A+
Sbjct: 3308 SASTSASASASTSASASASTSASASASTSAS 3338

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 98/329 (29%), Positives = 170/329 (50%), Gaps = 4/329 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 1402 SASTSASASASTSASASASTSASAS-ASTSASASASTSASASASTSA-------SASAST 1453

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A IS   SA ++  A+ +++ SA   T  S  AS         S S +   +S+ 
Sbjct: 1454 SASASASISASESASTSASASASTSASASASTSASVSASTSASASASTSASAS---ASIS 1510

Query: 768  ATLPVTSSM*AGASSS*RISAP---SRSASRAAMAASDISASMSASSITKGMSSKPGRSA 598
            A+   ++S  A AS+S   SA    S SAS +A A++ ISAS SAS+     +S    ++
Sbjct: 1511 ASESASTSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASAS 1570

Query: 597  RTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTL 421
             +++  +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST 
Sbjct: 1571 ASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTS 1630

Query: 420  RTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTS 241
             + +       +TS +   +  AS    T         + + ++ST  +V + +  S ++
Sbjct: 1631 ASESA------STSASASASTSASASAST---------SASASASTSASVSASTSASESA 1675

Query: 240  SSLIALAACSAAGASANTRTEGRTPVNAT 154
            S+  + +A ++A ASA+T        +A+
Sbjct: 1676 STSASASASTSASASASTSASASASTSAS 1704

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 101/326 (30%), Positives = 168/326 (50%), Gaps = 1/326 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+SV         S    +S  A T +       ++S+S+
Sbjct: 1642 SASTSASASASTSASASASTSASVS-ASTSASESASTSASASASTSA-------SASAST 1693

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S  AS         S S +   +S  
Sbjct: 1694 SASASASTSASESASTSASASASTSASASASTSASESASTSASASASTSASAS---ASTS 1750

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSAS-SITKGMSSKPGRSART 592
            A+   ++S  A AS+S   ++ S SAS +A A++  SAS SAS S ++  S+    SA T
Sbjct: 1751 ASASASTSASASASAS---TSASASASTSASASASTSASASASISASESASTSASESAST 1807

Query: 591  STWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSASTLRTL 412
            ST  +S+STS S S+S +++ S S S   S+ +SA ASA+T+  S+S +   SAST  + 
Sbjct: 1808 ST-SASASTSASESASTSASASASTSASASASTSASASASTS-ASASTSASESASTSASA 1865

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            +       +TS +   +  AS    T     A     A ++ST  +V + +  S ++S+ 
Sbjct: 1866 SA------STSASASASTSASASASTSASASASTSASA-SASTSASVSASTSASASASTS 1918

Query: 231  IALAACSAAGASANTRTEGRTPVNAT 154
             + +A ++A  SA+T        +A+
Sbjct: 1919 ASASASTSASESASTSASASASTSAS 1944

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 102/325 (31%), Positives = 166/325 (50%), Gaps = 5/325 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 2574 SASTSASASASTSASASASTSASAS-ASTSASESASTSASASASTSA-------SASAST 2625

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*S-SM 772
             +S  A  S   SA ++  A+ +++ SA   T  S+ AS         S S +   S S 
Sbjct: 2626 SASESASTSASASASTSASASASTSASASASTSASASASASTSASASASTSASASASTSA 2685

Query: 771  RATLPVTSSM*AGASSS*RISAP---SRSASRAAMAASDISASMSAS-SITKGMSSKPGR 604
             A+  +++S  A  S+S   SA    S SAS +A A++  SAS SAS S ++  S+    
Sbjct: 2686 SASASISASESASTSASASASASTSASASASTSASASASTSASASASISASESASTSASE 2745

Query: 603  SARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSAST 424
            SA TST  +S+STS S S+S +++ S S S   S+ +SA ASA+T+  S+S +   SAST
Sbjct: 2746 SASTST-SASASTSASESASTSASASASTSASASASTSASASASTS-ASASTSASESAST 2803

Query: 423  LRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFT 244
              + +       +TS +   +  AS    T     A     A ++ST  +V + +  S +
Sbjct: 2804 SASASA------STSASASASTSASASASTSASASASTSASA-SASTSASVSASTSASAS 2856

Query: 243  SSSLIALAACSAAGASANTRTEGRT 169
            +S+  + +A ++A  SA+T     T
Sbjct: 2857 ASTSASASASTSASESASTSASAST 2881

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 96/328 (29%), Positives = 163/328 (49%), Gaps = 3/328 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S S+S +A+ASA TS+S          S    +ST A   +       + S+S+
Sbjct: 2754 SASTSASESASTSASASASTSASAS-----ASTSASASASTSASASTSA-----SESAST 2803

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S+ AS    V    S S +   +S  
Sbjct: 2804 SASASASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASASAS-TSAS 2862

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            A+   ++S  A  S+S   SA S SAS +A A++  SAS SAS+     +S     + ++
Sbjct: 2863 ASASTSASESASTSASASTSA-SESASTSASASASTSASASASTSASASASTSASESAST 2921

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT---ADLSSSDTRFFSASTLR 418
            +  +S+STS S+S+S +++ S S S   S+ +SA ASA+T   A  S+S +   S S   
Sbjct: 2922 SASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASESASTSASA 2981

Query: 417  TLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSS 238
            + + +     +TS +   +  AS    T     A   T A ++ST  +  + +  S ++S
Sbjct: 2982 SASTSASESASTSASASASTSASASASTSASGSASTSTSA-SASTSASASASTSASASAS 3040

Query: 237  SLIALAACSAAGASANTRTEGRTPVNAT 154
               + +A ++A  SA+T T      +A+
Sbjct: 3041 ISASESASTSASESASTSTSASASTSAS 3068

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 94/326 (28%), Positives = 166/326 (50%), Gaps = 1/326 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       + S+S+
Sbjct: 2082 SASTSASASASTSASASASTSASAS-ASTSASESASTSASASASTSA-------SESAST 2133

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S+ AS         S S +T  +S  
Sbjct: 2134 SASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASTS-ASES 2192

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            A+   ++S    AS+S   SA S SAS +A  ++  SAS SAS+     +S    ++ ++
Sbjct: 2193 ASTSASASASTSASASASTSA-SASASTSASESASTSASASASTSASASASTSASASAST 2251

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRTL 412
            +  +S+STS S+S+S++++ S S S   S+ +SA  SA+T A  S+S +   SAST  + 
Sbjct: 2252 SASASASTSASASASISASESASTSASASASTSASVSASTSASASASTSASESASTSASA 2311

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            +       +TS +   +  AS    T     A   + + ++ST  +  + +  S ++S+ 
Sbjct: 2312 SA------STSASESASTSASASASTSASASA-SISASESASTSASASASTSASASASTS 2364

Query: 231  IALAACSAAGASANTRTEGRTPVNAT 154
             + +A ++A  SA+T T      +A+
Sbjct: 2365 ASASASTSASESASTSTSASASTSAS 2390

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 94/326 (28%), Positives = 166/326 (50%), Gaps = 1/326 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       + S+S+
Sbjct: 838  SASTSASASASTSASASASTSASAS-ASTSASESASTSASASASTSA-------SESAST 889

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S+ AS         S S +T  +S  
Sbjct: 890  SASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASTS-ASES 948

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            A+   ++S    AS+S   SA S SAS +A  ++  SAS SAS+     +S    ++ ++
Sbjct: 949  ASTSASASASTSASASASTSA-SASASTSASESASTSASASASTSASASASTSASASAST 1007

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRTL 412
            +  +S+STS S+S+S++++ S S S   S+ +SA  SA+T A  S+S +   SAST  + 
Sbjct: 1008 SASASASTSASASASISASESASTSASASASTSASVSASTSASASASTSASESASTSASA 1067

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            +       +TS +   +  AS    T     A   + + ++ST  +  + +  S ++S+ 
Sbjct: 1068 SA------STSASESASTSASASASTSASASA-SISASESASTSASASASTSASASASTS 1120

Query: 231  IALAACSAAGASANTRTEGRTPVNAT 154
             + +A ++A  SA+T T      +A+
Sbjct: 1121 ASASASTSASESASTSTSASASTSAS 1146

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 94/326 (28%), Positives = 166/326 (50%), Gaps = 1/326 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       + S+S+
Sbjct: 3324 SASTSASASASTSASASASTSASAS-ASTSASESASTSASASASTSA-------SESAST 3375

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S+ AS         S S +T  +S  
Sbjct: 3376 SASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASTS-ASES 3434

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            A+   ++S    AS+S   SA S SAS +A  ++  SAS SAS+     +S    ++ ++
Sbjct: 3435 ASTSASASASTSASASASTSA-SASASTSASESASTSASASASTSASASASTSASASAST 3493

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRTL 412
            +  +S+STS S+S+S++++ S S S   S+ +SA  SA+T A  S+S +   SAST  + 
Sbjct: 3494 SASASASTSASASASISASESASTSASASASTSASVSASTSASASASTSASESASTSASA 3553

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            +       +TS +   +  AS    T     A   + + ++ST  +  + +  S ++S+ 
Sbjct: 3554 SA------STSASESASTSASASASTSASASA-SISASESASTSASASASTSASASASTS 3606

Query: 231  IALAACSAAGASANTRTEGRTPVNAT 154
             + +A ++A  SA+T T      +A+
Sbjct: 3607 ASASASTSASESASTSTSASASTSAS 3632

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 100/326 (30%), Positives = 167/326 (50%), Gaps = 1/326 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 4406 SASTSASASASTSASASASTSASAS-ASTSASASASTSASASASTSA-------SASAST 4457

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S+ AS         S S +   +S  
Sbjct: 4458 SASASASTSASASASTSASASASTSASASASTSASASASTSASASASISASES---ASTS 4514

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            A+   ++S  A AS+S  +SA S SAS +A  ++  SAS+SAS   +  S+    SA TS
Sbjct: 4515 ASASASTSASASASTSASVSA-STSASASASTSASASASISAS---ESASTSASASASTS 4570

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRTL 412
               +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  + 
Sbjct: 4571 A-SASASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASA 4629

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            +       +TS +   +  AS    T     A     A ++ST  +  + +  S ++S+ 
Sbjct: 4630 SA------STSASASASTSASASASTSASASASTSASA-SASTSASASASTSASASASTS 4682

Query: 231  IALAACSAAGASANTRTEGRTPVNAT 154
             + +A ++A ASA+T        +A+
Sbjct: 4683 ASASASTSASASASTSASASASTSAS 4708

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 96/338 (28%), Positives = 168/338 (49%), Gaps = 13/338 (3%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 1602 SASTSASASASTSASASASTSASAS-ASTSASESASTSASASASTSASA---SASTSASA 1657

Query: 948  GSSTKAGISKPVSA-HSARRAA*ASAD---SAELGTFISSLASRPVRVLPFHSNSRNTP* 781
             +ST A +S   SA  SA  +A ASA    SA   T  S+ AS         S S +T  
Sbjct: 1658 SASTSASVSASTSASESASTSASASASTSASASASTSASASASTSA------SESASTSA 1711

Query: 780  SSMRATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRS 601
            S+  +T    S+  + + S+   ++ S S S +A A++  SAS S S+     +S    +
Sbjct: 1712 SASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASASTSASA 1771

Query: 600  ARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT---------ADLSSSD 448
            + +++  +S+STS S+S+S++++ S S S   S+ +S  ASA+T         A  S+S 
Sbjct: 1772 SASTSASASASTSASASASISASESASTSASESASTSTSASASTSASESASTSASASAST 1831

Query: 447  TRFFSASTLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVP 268
            +   SAST  + + +     +TS +   +  AS    T     A     A ++ST  +  
Sbjct: 1832 SASASASTSASASASTSASASTSASESASTSASASASTSASASASTSASA-SASTSASAS 1890

Query: 267  SYSEPSFTSSSLIALAACSAAGASANTRTEGRTPVNAT 154
            + +  S ++S+  +++A ++A ASA+T        +A+
Sbjct: 1891 ASTSASASASTSASVSASTSASASASTSASASASTSAS 1928

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 100/326 (30%), Positives = 167/326 (50%), Gaps = 1/326 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 1362 SASTSASASASTSASASASTSASAS-ASTSASASASTSASASASTSA-------SASAST 1413

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S+ AS         S S +   +S  
Sbjct: 1414 SASASASTSASASASTSASASASTSASASASTSASASASTSASASASISASES---ASTS 1470

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            A+   ++S  A AS+S  +SA S SAS +A  ++  SAS+SAS   +  S+    SA TS
Sbjct: 1471 ASASASTSASASASTSASVSA-STSASASASTSASASASISAS---ESASTSASASASTS 1526

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRTL 412
               +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  + 
Sbjct: 1527 A-SASASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASA 1585

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            +       +TS +   +  AS    T     A     A ++ST  +  + +  S ++S+ 
Sbjct: 1586 SA------STSASASASTSASASASTSASASASTSASA-SASTSASASASTSASESASTS 1638

Query: 231  IALAACSAAGASANTRTEGRTPVNAT 154
             + +A ++A ASA+T        +A+
Sbjct: 1639 ASASASTSASASASTSASASASTSAS 1664

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 96/329 (29%), Positives = 169/329 (51%), Gaps = 4/329 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 3888 SASTSASASASTSASASASTSASAS-ASTSASASASTSASASASTSA-------SASAST 3939

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A IS   SA ++  A+ +++ SA   T  S  AS         S S +   +S+ 
Sbjct: 3940 SASASASISASESASTSASASASTSASASASTSASVSASTSASASASTSASAS---ASIS 3996

Query: 768  ATLPVTSSM*AGASSS*RISAP---SRSASRAAMAASDISASMSASSITKGMSSKPGRSA 598
            A+   ++S  A AS+S   SA    S SAS +A A++ ISAS SAS+     +S    ++
Sbjct: 3997 ASESASTSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASAS 4056

Query: 597  RTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTL 421
             +++  +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST 
Sbjct: 4057 ASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTS 4116

Query: 420  RTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTS 241
             + +       +TS +   +  AS          +   + + ++ST  +  + +  S ++
Sbjct: 4117 ASESA------STSASASASTSAS---------ASASISASESASTSASASASTSASASA 4161

Query: 240  SSLIALAACSAAGASANTRTEGRTPVNAT 154
            S+  + +A ++A  SA+T T      +A+
Sbjct: 4162 STSASASASTSASESASTSTSASASTSAS 4190

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 96/329 (29%), Positives = 167/329 (50%), Gaps = 4/329 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 3268 SASTSASASASTSASASASTSASAS-ASTSASESASTSASASASTSA-------SASAST 3319

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S  AS         S S +   +S  
Sbjct: 3320 SASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASES---ASTS 3376

Query: 768  ATLPVTSSM*AGASSS*RISAP-SRSASRAAMAASDISASMSASSITKGMSSKPGRSART 592
            A+   ++S  A AS+S   SA  S SAS +  A++  S S SAS+ T   +S     + +
Sbjct: 3377 ASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASTSASESAS 3436

Query: 591  STWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRT 415
            ++  +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  +
Sbjct: 3437 TSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSAS 3496

Query: 414  LTVTFWPG*TTSLAF--LVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTS 241
             + +     + S++     +  AS    T   V A     A ++ST  +  + +  S ++
Sbjct: 3497 ASASTSASASASISASESASTSASASASTSASVSASTSASA-SASTSASESASTSASASA 3555

Query: 240  SSLIALAACSAAGASANTRTEGRTPVNAT 154
            S+  + +A ++A ASA+T       ++A+
Sbjct: 3556 STSASESASTSASASASTSASASASISAS 3584

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 96/329 (29%), Positives = 167/329 (50%), Gaps = 4/329 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 782  SASTSASASASTSASASASTSASAS-ASTSASESASTSASASASTSA-------SASAST 833

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S  AS         S S +   +S  
Sbjct: 834  SASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASES---ASTS 890

Query: 768  ATLPVTSSM*AGASSS*RISAP-SRSASRAAMAASDISASMSASSITKGMSSKPGRSART 592
            A+   ++S  A AS+S   SA  S SAS +  A++  S S SAS+ T   +S     + +
Sbjct: 891  ASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASTSASESAS 950

Query: 591  STWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRT 415
            ++  +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  +
Sbjct: 951  TSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSAS 1010

Query: 414  LTVTFWPG*TTSLAF--LVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTS 241
             + +     + S++     +  AS    T   V A     A ++ST  +  + +  S ++
Sbjct: 1011 ASASTSASASASISASESASTSASASASTSASVSASTSASA-SASTSASESASTSASASA 1069

Query: 240  SSLIALAACSAAGASANTRTEGRTPVNAT 154
            S+  + +A ++A ASA+T       ++A+
Sbjct: 1070 STSASESASTSASASASTSASASASISAS 1098

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 96/329 (29%), Positives = 167/329 (50%), Gaps = 4/329 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 2026 SASTSASASASTSASASASTSASAS-ASTSASESASTSASASASTSA-------SASAST 2077

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S  AS         S S +   +S  
Sbjct: 2078 SASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASES---ASTS 2134

Query: 768  ATLPVTSSM*AGASSS*RISAP-SRSASRAAMAASDISASMSASSITKGMSSKPGRSART 592
            A+   ++S  A AS+S   SA  S SAS +  A++  S S SAS+ T   +S     + +
Sbjct: 2135 ASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASTSASESAS 2194

Query: 591  STWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRT 415
            ++  +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  +
Sbjct: 2195 TSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASASASTSAS 2254

Query: 414  LTVTFWPG*TTSLAF--LVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTS 241
             + +     + S++     +  AS    T   V A     A ++ST  +  + +  S ++
Sbjct: 2255 ASASTSASASASISASESASTSASASASTSASVSASTSASA-SASTSASESASTSASASA 2313

Query: 240  SSLIALAACSAAGASANTRTEGRTPVNAT 154
            S+  + +A ++A ASA+T       ++A+
Sbjct: 2314 STSASESASTSASASASTSASASASISAS 2342

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 101/329 (30%), Positives = 166/329 (49%), Gaps = 4/329 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 2192 SASTSASASASTSASASASTSASAS-ASTSASESASTSASASASTSASA---SASTSASA 2247

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +ST A  S   SA ++  A+ ++++SA      S+  S  V      S S +T  +S  
Sbjct: 2248 SASTSASASASTSASAS--ASISASESASTSASASASTSASVSASTSASASASTS-ASES 2304

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSAS-SITKGMSSKPGRSART 592
            A+   ++S    AS S   SA S SAS +A A++ ISAS SAS S +   S+    SA T
Sbjct: 2305 ASTSASASASTSASESASTSA-SASASTSASASASISASESASTSASASASTSASASAST 2363

Query: 591  STWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAA---TADLSSSDTRFFSASTL 421
            S   +S+S STS+S S +++ S S S   S  +S  ASA+   +A  S+S +   SAST 
Sbjct: 2364 S---ASASASTSASESASTSTSASASTSASESASTSASASASTSASASASTSASASASTS 2420

Query: 420  RTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTS 241
             + + +     +TS +   +  AS    T     A     A ++ST  +  + +  S ++
Sbjct: 2421 ASASASTSASASTSASESASTSASASASTSASASASTSASA-SASTSASASASTSASASA 2479

Query: 240  SSLIALAACSAAGASANTRTEGRTPVNAT 154
            S+  + +A ++A ASA+T        +A+
Sbjct: 2480 STSASASASTSASASASTSASASASTSAS 2508

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 99/334 (29%), Positives = 167/334 (49%), Gaps = 9/334 (2%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          ST   +ST A   +       ++S+S+
Sbjct: 4152 SASTSASASASTSASASASTSASES-----ASTSTSASASTSASESAS-----TSASASA 4201

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*S--- 778
             +S  A  S   SA ++  A+ +++ SA   T  S  AS         S S +   S   
Sbjct: 4202 STSASASASTSASASASTSASASASTSASASTSASESASTSASASASTSASASASTSASA 4261

Query: 777  --SMRATLPVTSSM*AGASSS*RISAP---SRSASRAAMAASDISASMSASSITKGMSSK 613
              S  A+   ++S  A AS+S   SA    S SAS +A A++  SAS SAS+     +S 
Sbjct: 4262 SASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASAST 4321

Query: 612  PGRSARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFF 436
               ++ +++  +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   
Sbjct: 4322 SASASASTSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASE 4381

Query: 435  SASTLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSE 256
            SAST  + +       +TS +   +  AS    T     A     A ++ST  +  + + 
Sbjct: 4382 SASTSASASA------STSASESASTSASASASTSASASASTSASA-SASTSASASASTS 4434

Query: 255  PSFTSSSLIALAACSAAGASANTRTEGRTPVNAT 154
             S ++S+  + +A ++A ASA+T        +A+
Sbjct: 4435 ASASASTSASASASTSASASASTSASASASTSAS 4468

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 101/329 (30%), Positives = 166/329 (49%), Gaps = 4/329 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 3434 SASTSASASASTSASASASTSASAS-ASTSASESASTSASASASTSASA---SASTSASA 3489

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +ST A  S   SA ++  A+ ++++SA      S+  S  V      S S +T  +S  
Sbjct: 3490 SASTSASASASTSASAS--ASISASESASTSASASASTSASVSASTSASASASTS-ASES 3546

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSAS-SITKGMSSKPGRSART 592
            A+   ++S    AS S   SA S SAS +A A++ ISAS SAS S +   S+    SA T
Sbjct: 3547 ASTSASASASTSASESASTSA-SASASTSASASASISASESASTSASASASTSASASAST 3605

Query: 591  STWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAA---TADLSSSDTRFFSASTL 421
            S   +S+S STS+S S +++ S S S   S  +S  ASA+   +A  S+S +   SAST 
Sbjct: 3606 S---ASASASTSASESASTSTSASASTSASESASTSASASASTSASASASTSASASASTS 3662

Query: 420  RTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTS 241
             + + +     +TS +   +  AS    T     A     A ++ST  +  + +  S ++
Sbjct: 3663 ASASASTSASASTSASESASTSASASASTSASASASTSASA-SASTSASASASTSASASA 3721

Query: 240  SSLIALAACSAAGASANTRTEGRTPVNAT 154
            S+  + +A ++A ASA+T        +A+
Sbjct: 3722 STSASASASTSASASASTSASASASTSAS 3750

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 101/329 (30%), Positives = 166/329 (49%), Gaps = 4/329 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 948  SASTSASASASTSASASASTSASAS-ASTSASESASTSASASASTSASA---SASTSASA 1003

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +ST A  S   SA ++  A+ ++++SA      S+  S  V      S S +T  +S  
Sbjct: 1004 SASTSASASASTSASAS--ASISASESASTSASASASTSASVSASTSASASASTS-ASES 1060

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSAS-SITKGMSSKPGRSART 592
            A+   ++S    AS S   SA S SAS +A A++ ISAS SAS S +   S+    SA T
Sbjct: 1061 ASTSASASASTSASESASTSA-SASASTSASASASISASESASTSASASASTSASASAST 1119

Query: 591  STWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAA---TADLSSSDTRFFSASTL 421
            S   +S+S STS+S S +++ S S S   S  +S  ASA+   +A  S+S +   SAST 
Sbjct: 1120 S---ASASASTSASESASTSTSASASTSASESASTSASASASTSASASASTSASASASTS 1176

Query: 420  RTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTS 241
             + + +     +TS +   +  AS    T     A     A ++ST  +  + +  S ++
Sbjct: 1177 ASASASTSASASTSASESASTSASASASTSASASASTSASA-SASTSASASASTSASASA 1235

Query: 240  SSLIALAACSAAGASANTRTEGRTPVNAT 154
            S+  + +A ++A ASA+T        +A+
Sbjct: 1236 STSASASASTSASASASTSASASASTSAS 1264

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 95/339 (28%), Positives = 169/339 (49%), Gaps = 14/339 (4%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+SV         S    +S  A T +       ++S+S+
Sbjct: 2542 SASTSASASASTSASASASTSASVS-ASTSASESASTSASASASTSA-------SASAST 2593

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S  AS         S S +   +S  
Sbjct: 2594 SASASASTSASESASTSASASASTSASASASTSASESASTSASASASTSASASAS-TSAS 2652

Query: 768  ATLPVTSSM*AGASSS*RISAP---SRSASRAAMAASDISASMSASSITKGMSSKPGRSA 598
            A+   ++S  A AS+S   SA    S SAS +A A++ ISAS SAS+     +S    ++
Sbjct: 2653 ASASTSASASASASTSASASASTSASASASTSASASASISASESASTSASASASASTSAS 2712

Query: 597  RTSTWPSSSSTSTSSSSSVASAPSRSGSVIMS-----------SDSSADASAATADLSSS 451
             +++  +S+S STS+S+S + + S S S   S           S S++++++ +A  S+S
Sbjct: 2713 ASASTSASASASTSASASASISASESASTSASESASTSTSASASTSASESASTSASASAS 2772

Query: 450  DTRFFSASTLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTV 271
             +   SAST  + + +     +TS +   +  AS    T     A     A ++ST  + 
Sbjct: 2773 TSASASASTSASASASTSASASTSASESASTSASASASTSASASASTSASA-SASTSASA 2831

Query: 270  PSYSEPSFTSSSLIALAACSAAGASANTRTEGRTPVNAT 154
             + +  S ++S+  +++A ++A ASA+T        +A+
Sbjct: 2832 SASTSASASASTSASVSASTSASASASTSASASASTSAS 2870

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 101/327 (30%), Positives = 165/327 (49%), Gaps = 2/327 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S  A+ASA TS+S          S  + +S  A T +       + S+S+
Sbjct: 1758 SASASASASTS--ASASASTSASAS-ASTSASASASISASESASTSA-------SESAST 1807

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S+ AS         S S +T  +S  
Sbjct: 1808 STSASASTSASESASTSASASASTSASASASTSASASASTSASASTSASESASTS-ASAS 1866

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            A+   ++S    AS+S   SA S SAS +A A++  SAS+SAS+     +S    ++ ++
Sbjct: 1867 ASTSASASASTSASASASTSA-SASASTSASASASTSASVSASTSASASASTSASASAST 1925

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRTL 412
            +   S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  + 
Sbjct: 1926 SASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSASA 1985

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            +       +TS +   +  AS    T     A   T A  S+++    S S  +  S+S 
Sbjct: 1986 SA------STSASASASTSASASASTS--ASASASTSASASASISASESASTSASASAST 2037

Query: 231  IALAACS-AAGASANTRTEGRTPVNAT 154
             A A+ S +A ASA+T        +A+
Sbjct: 2038 SASASASTSASASASTSASESASTSAS 2064

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 93/327 (28%), Positives = 168/327 (50%), Gaps = 2/327 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       TS+S+S
Sbjct: 2950 SASTSASASASTSASASASTSASES-ASTSASASASTSASESASTSASA--SASTSASAS 3006

Query: 948  GSSTKAGISKPVSAHSARRAA*ASAD-SAELGTFISSLASRPVRVLPFHSNSRNTP*SSM 772
             S++ +G +   ++ SA  +A ASA  SA     IS+  S         S S +   S+ 
Sbjct: 3007 ASTSASGSASTSTSASASTSASASASTSASASASISASESASTSASESASTSTSASASTS 3066

Query: 771  RATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSART 592
             +    TS+  + ++S+   ++ S SAS +  A++  SAS SAS+     +S    ++ +
Sbjct: 3067 ASESASTSASASASTSASASASTSASASASTSASASTSASESASTSASASASTSASASAS 3126

Query: 591  STWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRT 415
            ++  +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  +
Sbjct: 3127 TSASASASTSASASASTSASVSASTSASASASTSASASASTSASESASTSASASASTSAS 3186

Query: 414  LTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSS 235
             +       +TS +   +  AS    T     A   + + ++ST  +  + +  S ++S+
Sbjct: 3187 ASA------STSASASASTSASASASTSASASA-STSASESASTSASASASTSASASAST 3239

Query: 234  LIALAACSAAGASANTRTEGRTPVNAT 154
              + +A ++A ASA+T       ++A+
Sbjct: 3240 SASASASTSASASASTSASASASISAS 3266

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 100/332 (30%), Positives = 165/332 (49%), Gaps = 7/332 (2%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 2886 SASTSASASASTSASASASTSASAS-ASTSASESASTSASASASTSA-------SASAST 2937

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S  AS         S S +   +S  
Sbjct: 2938 SASESASTSASASASTSASASASTSASASASTSASESASTSASASASTSASES---ASTS 2994

Query: 768  ATLPVTSSM*AGASSS*RISAP---SRSASRAAMAASDISASMSAS-SITKGMSSKPGRS 601
            A+   ++S  A AS+S   SA    S SAS +A A++  SAS SAS S ++  S+    S
Sbjct: 2995 ASASASTSASASASTSASGSASTSTSASASTSASASASTSASASASISASESASTSASES 3054

Query: 600  ARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAA---TADLSSSDTRFFSA 430
            A TST   S+S STS+S S +++ S S S   S+ +S  ASA+   +A  S+S +   S 
Sbjct: 3055 ASTST---SASASTSASESASTSASASASTSASASASTSASASASTSASASTSASESAST 3111

Query: 429  STLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPS 250
            S   + + +     +TS +   +  AS    T   V A     A ++ST  +  + +  S
Sbjct: 3112 SASASASTSASASASTSASASASTSASASASTSASVSASTSASA-SASTSASASASTSAS 3170

Query: 249  FTSSSLIALAACSAAGASANTRTEGRTPVNAT 154
             ++S+  + +A ++A ASA+T        +A+
Sbjct: 3171 ESASTSASASASTSASASASTSASASASTSAS 3202

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 93/327 (28%), Positives = 168/327 (50%), Gaps = 2/327 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       TS+S+S
Sbjct: 464  SASTSASASASTSASASASTSASES-ASTSASASASTSASESASTSASA--SASTSASAS 520

Query: 948  GSSTKAGISKPVSAHSARRAA*ASAD-SAELGTFISSLASRPVRVLPFHSNSRNTP*SSM 772
             S++ +G +   ++ SA  +A ASA  SA     IS+  S         S S +   S+ 
Sbjct: 521  ASTSASGSASTSTSASASTSASASASTSASASASISASESASTSASESASTSTSASASTS 580

Query: 771  RATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSART 592
             +    TS+  + ++S+   ++ S SAS +  A++  SAS SAS+     +S    ++ +
Sbjct: 581  ASESASTSASASASTSASASASTSASASASTSASASTSASESASTSASASASTSASASAS 640

Query: 591  STWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRT 415
            ++  +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  +
Sbjct: 641  TSASASASTSASASASTSASVSASTSASASASTSASASASTSASESASTSASASASTSAS 700

Query: 414  LTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSS 235
             +       +TS +   +  AS    T     A   + + ++ST  +  + +  S ++S+
Sbjct: 701  ASA------STSASASASTSASASASTSASASA-STSASESASTSASASASTSASASAST 753

Query: 234  LIALAACSAAGASANTRTEGRTPVNAT 154
              + +A ++A ASA+T       ++A+
Sbjct: 754  SASASASTSASASASTSASASASISAS 780

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 95/327 (29%), Positives = 162/327 (49%), Gaps = 2/327 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S  + +S  A T +       ++S+S+
Sbjct: 1514 SASTSASASASTSASASASTSASAS-ASTSASASASISASESASTSA-------SASAST 1565

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*S-SM 772
             +S  A  S   SA ++  A+ +++ SA   T  S+ AS         S S +   S S 
Sbjct: 1566 SASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASA 1625

Query: 771  RATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSART 592
             A+   + S    AS+S   SA S SAS +A A++  SAS+SAS+     +S    ++ +
Sbjct: 1626 SASTSASESASTSASASASTSA-SASASTSASASASTSASVSASTSASESASTSASASAS 1684

Query: 591  STWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSASTLRTL 412
            ++  +S+STS S+S+S +++ S S S   S+ +SA ASA+T+   S+ T   +++     
Sbjct: 1685 TSASASASTSASASASTSASESASTSASASASTSASASASTSASESASTSASASA----- 1739

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
                    +TS +   +  AS    T     A   T A  S++     S S  +  S+S+
Sbjct: 1740 --------STSASASASTSASASASTSASASASASTSASASASTSASASASTSASASASI 1791

Query: 231  IAL-AACSAAGASANTRTEGRTPVNAT 154
             A  +A ++A  SA+T T      +A+
Sbjct: 1792 SASESASTSASESASTSTSASASTSAS 1818

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 96/334 (28%), Positives = 168/334 (49%), Gaps = 9/334 (2%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 4080 SASTSASASASTSASASASTSASAS-ASTSASASASTSASESASTSA-------SASAST 4131

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*S--- 778
             +S  A IS   SA ++  A+ +++ SA   T  S+ AS         S S +   S   
Sbjct: 4132 SASASASISASESASTSASASASTSASASASTSASASASTSASESASTSTSASASTSASE 4191

Query: 777  --SMRATLPVTSSM*AGASSS*RISAP-SRSASRAAMAASDISASMSASSITKGMSSKPG 607
              S  A+   ++S  A AS+S   SA  S SAS +  A++  SAS SAS+     +S   
Sbjct: 4192 SASTSASASASTSASASASTSASASASTSASASASTSASASTSASESASTSASASASTSA 4251

Query: 606  RSARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT---ADLSSSDTRFF 436
             ++ +++  +S+STS S+S+S +++ S S S   S+ +SA ASA+T   A  S+S +   
Sbjct: 4252 SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESA 4311

Query: 435  SASTLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSE 256
            S S   + + +     +TS +   +  AS    T   V A   + + ++ST  +  + + 
Sbjct: 4312 STSASASASTSASASASTSASASASTSASASASTSASVSA-STSASESASTSASASASTS 4370

Query: 255  PSFTSSSLIALAACSAAGASANTRTEGRTPVNAT 154
             S ++S+  + +A ++A ASA+T        +A+
Sbjct: 4371 ASASASTSASESASTSASASASTSASESASTSAS 4404

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 95/318 (29%), Positives = 160/318 (49%), Gaps = 1/318 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S     +    S    +S  A T +       ++S+S+
Sbjct: 4008 SASTSASASASTSASASASTSASAS-ASISASESASTSASASASTSA-------SASAST 4059

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*S-SM 772
             +S  A  S   SA ++  A+ +++ SA   T  S+ AS         S S +   S S 
Sbjct: 4060 SASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASE 4119

Query: 771  RATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSART 592
             A+   ++S    AS+S  ISA S SAS +A A++  SAS SAS+      S    ++ +
Sbjct: 4120 SASTSASASASTSASASASISA-SESASTSASASASTSASASAST------SASASASTS 4172

Query: 591  STWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSASTLRTL 412
            ++  +S+STS S+S+S + + S S S   S+ +SA AS  +A  S+S +   SAST  + 
Sbjct: 4173 ASESASTSTSASASTSASESASTSASASASTSASASAS-TSASASASTSASASASTSASA 4231

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            + +     +TS +   +  AS    T     A     A  S++     S S  +  S+S 
Sbjct: 4232 STSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA 4291

Query: 231  IALAACSAAGASANTRTE 178
             A A+ SA+ +++ + +E
Sbjct: 4292 SASASTSASASASTSASE 4309

 Score = 93.2 bits (230), Expect = 7e-18
 Identities = 104/341 (30%), Positives = 164/341 (47%), Gaps = 16/341 (4%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S  + +S  A T +       + S+S+
Sbjct: 2698 STSASASASASTSASASASTSASAS-ASTSASASASISASESASTSA-------SESAST 2749

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*S--- 778
             +S  A  S   SA ++  A+ +++ SA   T  S+ AS         S S +T  S   
Sbjct: 2750 STSASASTSASESASTSASASASTSASASASTSASASASTSASASTSASESASTSASASA 2809

Query: 777  SMRATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSAS-----SITKGMSSK 613
            S  A+   ++S  A AS+S   SA S SAS +A  ++ +SAS SAS     S +   S+ 
Sbjct: 2810 STSASASASTSASASASTSASASA-STSASASASTSASVSASTSASASASTSASASASTS 2868

Query: 612  PGRSARTSTWPSSS---STSTSSSSSVASAPSRSGSVIMSSDSSADAS-----AATADLS 457
               SA TS   S+S   S STS+S+S +++ S S S   S+ +S  AS     +A+A  S
Sbjct: 2869 ASESASTSASASTSASESASTSASASASTSASASASTSASASASTSASESASTSASASAS 2928

Query: 456  SSDTRFFSASTLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVV 277
            +S +   S S   + + +     +TS +   +  AS    T     A     A  S++  
Sbjct: 2929 TSASASASTSASESASTSASASASTSASASASTSASASASTSASESASTSASASASTSAS 2988

Query: 276  TVPSYSEPSFTSSSLIALAACSAAGASANTRTEGRTPVNAT 154
               S S  +  S+S  A A+ SA+G SA+T T      +A+
Sbjct: 2989 ESASTSASASASTSASASASTSASG-SASTSTSASASTSAS 3028

 Score = 93.2 bits (230), Expect = 7e-18
 Identities = 98/327 (29%), Positives = 168/327 (50%), Gaps = 2/327 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ SA TS+S          ++   S++ + + S       ++S+S+
Sbjct: 1028 SASTSASASASTSASVSASTSASASASTSASESASTSASASASTSASESASTSASASAST 1087

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A IS   SA ++  A+ +++ SA   T  S+ AS         S S +T  +S  
Sbjct: 1088 SASASASISASESASTSASASASTSASASASTSASASASTSA------SESASTS-TSAS 1140

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            A+   + S    AS+S   SA S SAS +A A++  SAS SAS+ +   S+    SA TS
Sbjct: 1141 ASTSASESASTSASASASTSA-SASASTSASASASTSASASAST-SASASTSASESASTS 1198

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRTL 412
               +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  + 
Sbjct: 1199 A-SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASA 1257

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKA-PNSSTVVTVPSYSEPSFTSSS 235
            + +     + S +   +   S          A   T A  ++ST  +V + +  S ++S+
Sbjct: 1258 SASTSASESASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASESAST 1317

Query: 234  LIALAACSAAGASANTRTEGRTPVNAT 154
              + +A ++A ASA+T        +A+
Sbjct: 1318 SASASASTSASASASTSASESASTSAS 1344

 Score = 93.2 bits (230), Expect = 7e-18
 Identities = 98/327 (29%), Positives = 168/327 (50%), Gaps = 2/327 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ SA TS+S          ++   S++ + + S       ++S+S+
Sbjct: 3514 SASTSASASASTSASVSASTSASASASTSASESASTSASASASTSASESASTSASASAST 3573

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A IS   SA ++  A+ +++ SA   T  S+ AS         S S +T  +S  
Sbjct: 3574 SASASASISASESASTSASASASTSASASASTSASASASTSA------SESASTS-TSAS 3626

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            A+   + S    AS+S   SA S SAS +A A++  SAS SAS+ +   S+    SA TS
Sbjct: 3627 ASTSASESASTSASASASTSA-SASASTSASASASTSASASAST-SASASTSASESASTS 3684

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRTL 412
               +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  + 
Sbjct: 3685 A-SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASA 3743

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKA-PNSSTVVTVPSYSEPSFTSSS 235
            + +     + S +   +   S          A   T A  ++ST  +V + +  S ++S+
Sbjct: 3744 SASTSASESASTSASASASTSASASASTSASASASTSASASASTSASVSASTSASESAST 3803

Query: 234  LIALAACSAAGASANTRTEGRTPVNAT 154
              + +A ++A ASA+T        +A+
Sbjct: 3804 SASASASTSASASASTSASESASTSAS 3830

 Score = 93.2 bits (230), Expect = 7e-18
 Identities = 98/326 (30%), Positives = 168/326 (51%), Gaps = 1/326 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 3848 SASTSASASASTSASASASTSASAS-ASTSASASASTSASASASTSA-------SASAST 3899

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S+ AS         S S +   +S  
Sbjct: 3900 SASASASTSASASASTSASASASTSASASASTSASASASTSASASASISASES---ASTS 3956

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            A+   ++S  A AS+S  +SA S SAS +A  ++  SAS+SAS   +  S+    SA TS
Sbjct: 3957 ASASASTSASASASTSASVSA-STSASASASTSASASASISAS---ESASTSASASASTS 4012

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRTL 412
               +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  + 
Sbjct: 4013 A-SASASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASA 4071

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            +       +TS +   +  AS    T         + + ++ST  +  + +  S ++S+ 
Sbjct: 4072 SA------STSASASASTSASASAST---------SASASASTSASASASTSASASASTS 4116

Query: 231  IALAACSAAGASANTRTEGRTPVNAT 154
             + +A ++A ASA+T       ++A+
Sbjct: 4117 ASESASTSASASASTSASASASISAS 4142

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 94/330 (28%), Positives = 164/330 (49%), Gaps = 5/330 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 694  SASTSASASASTSASASASTSASAS-ASTSASASASTSASESASTSASA---SASTSASA 749

Query: 948  GSSTKAGISKPVSAH-SARRAA*ASAD-SAELGTFISSLASRPVRVLPFHSNSRNTP*SS 775
             +ST A  S   SA  SA  +A ASA  SA      S+ AS         S S +   S+
Sbjct: 750  SASTSASASASTSASASASTSASASASISASESASTSASASASTSASASASTSASASAST 809

Query: 774  MRATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSAR 595
              +    TS+  + ++S+   ++ S SAS +  A++  S S SAS+ T   +S    ++ 
Sbjct: 810  SASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASE 869

Query: 594  TSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAA---TADLSSSDTRFFSAST 424
            +++  +S+S STS+S S +++ S S S   S+ +S  ASA+   +A  S+S +   SAST
Sbjct: 870  SASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAST 929

Query: 423  LRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFT 244
              + + +     +TS +   +  AS    T     A     A ++ST  +  + +  S +
Sbjct: 930  SASASASTSASASTSASESASTSASASASTSASASASTSASA-SASTSASESASTSASAS 988

Query: 243  SSSLIALAACSAAGASANTRTEGRTPVNAT 154
            +S+  + +A ++A ASA+T        +A+
Sbjct: 989  ASTSASASASTSASASASTSASASASTSAS 1018

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 94/330 (28%), Positives = 164/330 (49%), Gaps = 5/330 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 1938 SASTSASASASTSASASASTSASAS-ASTSASASASTSASESASTSASA---SASTSASA 1993

Query: 948  GSSTKAGISKPVSAH-SARRAA*ASAD-SAELGTFISSLASRPVRVLPFHSNSRNTP*SS 775
             +ST A  S   SA  SA  +A ASA  SA      S+ AS         S S +   S+
Sbjct: 1994 SASTSASASASTSASASASTSASASASISASESASTSASASASTSASASASTSASASAST 2053

Query: 774  MRATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSAR 595
              +    TS+  + ++S+   ++ S SAS +  A++  S S SAS+ T   +S    ++ 
Sbjct: 2054 SASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASE 2113

Query: 594  TSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAA---TADLSSSDTRFFSAST 424
            +++  +S+S STS+S S +++ S S S   S+ +S  ASA+   +A  S+S +   SAST
Sbjct: 2114 SASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAST 2173

Query: 423  LRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFT 244
              + + +     +TS +   +  AS    T     A     A ++ST  +  + +  S +
Sbjct: 2174 SASASASTSASASTSASESASTSASASASTSASASASTSASA-SASTSASESASTSASAS 2232

Query: 243  SSSLIALAACSAAGASANTRTEGRTPVNAT 154
            +S+  + +A ++A ASA+T        +A+
Sbjct: 2233 ASTSASASASTSASASASTSASASASTSAS 2262

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 94/330 (28%), Positives = 164/330 (49%), Gaps = 5/330 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 3180 SASTSASASASTSASASASTSASAS-ASTSASASASTSASESASTSASA---SASTSASA 3235

Query: 948  GSSTKAGISKPVSAH-SARRAA*ASAD-SAELGTFISSLASRPVRVLPFHSNSRNTP*SS 775
             +ST A  S   SA  SA  +A ASA  SA      S+ AS         S S +   S+
Sbjct: 3236 SASTSASASASTSASASASTSASASASISASESASTSASASASTSASASASTSASASAST 3295

Query: 774  MRATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSAR 595
              +    TS+  + ++S+   ++ S SAS +  A++  S S SAS+ T   +S    ++ 
Sbjct: 3296 SASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASE 3355

Query: 594  TSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAA---TADLSSSDTRFFSAST 424
            +++  +S+S STS+S S +++ S S S   S+ +S  ASA+   +A  S+S +   SAST
Sbjct: 3356 SASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASAST 3415

Query: 423  LRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFT 244
              + + +     +TS +   +  AS    T     A     A ++ST  +  + +  S +
Sbjct: 3416 SASASASTSASASTSASESASTSASASASTSASASASTSASA-SASTSASESASTSASAS 3474

Query: 243  SSSLIALAACSAAGASANTRTEGRTPVNAT 154
            +S+  + +A ++A ASA+T        +A+
Sbjct: 3475 ASTSASASASTSASASASTSASASASTSAS 3504

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 89/326 (27%), Positives = 166/326 (50%), Gaps = 1/326 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 2910 SASTSASESASTSASASASTSASAS-ASTSASESASTSASASASTSASA-----SASTSA 2963

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S     S+  S  ++  A+ ++++SA      S+  S         S S +T  +S  
Sbjct: 2964 SASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASGSASTS-TSAS 3022

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            A+   ++S    AS+S  ISA   +++ A+ +AS  +++ +++S ++  S+    SA TS
Sbjct: 3023 ASTSASASASTSASASASISASESASTSASESASTSTSASASTSASESASTSASASASTS 3082

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRTL 412
               +S+S STS+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  + 
Sbjct: 3083 ---ASASASTSASASASTSASASTSASESASTSASASASTSASASASTSASASASTSASA 3139

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            +       +TS +   +  AS    T     A   + + ++ST  +  + +  S ++S+ 
Sbjct: 3140 SA------STSASVSASTSASASASTSASASA-STSASESASTSASASASTSASASASTS 3192

Query: 231  IALAACSAAGASANTRTEGRTPVNAT 154
             + +A ++A ASA+T        +A+
Sbjct: 3193 ASASASTSASASASTSASASASTSAS 3218

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 89/331 (26%), Positives = 162/331 (48%), Gaps = 6/331 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          ++  +S++ + + S       ++S+S+
Sbjct: 2400 SASTSASASASTSASASASTSASASASTSASASTSASESASTSASASAS----TSASASA 2455

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA      S+ AS         S S +   S+  
Sbjct: 2456 STSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA 2515

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            +    TS+  + ++S+   ++ S SAS +  A++  S S SAS+ T    S    ++ ++
Sbjct: 2516 SASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASVSASTSASESA 2575

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAA---TADLSSSDTRFFSASTLR 418
            +  +S+S STS+S+S +++ S S S   S  +S  ASA+   +A  S+S +   SAST  
Sbjct: 2576 STSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASESASTSA 2635

Query: 417  TLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSS 238
            + +       +TS +   +  AS    T     A   T A  S++     S S  +  S+
Sbjct: 2636 SASA------STSASASASTSASASASTSASASASASTSASASASTSASASASTSASASA 2689

Query: 237  SLIALAACS---AAGASANTRTEGRTPVNAT 154
            S+ A  + S   +A ASA+T        +A+
Sbjct: 2690 SISASESASTSASASASASTSASASASTSAS 2720

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 103/345 (29%), Positives = 165/345 (46%), Gaps = 20/345 (5%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+SV         ++   S++ + + S       ++S+S+
Sbjct: 638  SASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASESASTSASASAST 697

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*S-SM 772
             +S  A  S   SA ++  A+ +++ SA   T  S  AS         S S +   S S 
Sbjct: 698  SASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASA 757

Query: 771  RATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSAS-SITKGMSSKPGRSAR 595
             A+   ++S    AS+S  ISA S SAS +A A++  SAS SAS S +   S+    SA 
Sbjct: 758  SASTSASASASTSASASASISA-SESASTSASASASTSASASASTSASASASTSASESAS 816

Query: 594  TSTWPSSS-----STSTSSSSSVASAPSRSGSVIMSSDSSADASA-------------AT 469
            TS   S+S     S STS+S+S +++ S S S   S+ +S  ASA             A+
Sbjct: 817  TSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSAS 876

Query: 468  ADLSSSDTRFFSASTLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNS 289
            A  S+S +   S S   + + +     +TS +   +  AS    T     A     A  S
Sbjct: 877  ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 936

Query: 288  STVVTVPSYSEPSFTSSSLIALAACSAAGASANTRTEGRTPVNAT 154
            ++     S SE + TS+S    +A ++A ASA+T        +A+
Sbjct: 937  TSASASTSASESASTSAS---ASASTSASASASTSASASASTSAS 978

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 103/345 (29%), Positives = 165/345 (46%), Gaps = 20/345 (5%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+SV         ++   S++ + + S       ++S+S+
Sbjct: 1882 SASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASESASTSASASAST 1941

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*S-SM 772
             +S  A  S   SA ++  A+ +++ SA   T  S  AS         S S +   S S 
Sbjct: 1942 SASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASA 2001

Query: 771  RATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSAS-SITKGMSSKPGRSAR 595
             A+   ++S    AS+S  ISA S SAS +A A++  SAS SAS S +   S+    SA 
Sbjct: 2002 SASTSASASASTSASASASISA-SESASTSASASASTSASASASTSASASASTSASESAS 2060

Query: 594  TSTWPSSS-----STSTSSSSSVASAPSRSGSVIMSSDSSADASA-------------AT 469
            TS   S+S     S STS+S+S +++ S S S   S+ +S  ASA             A+
Sbjct: 2061 TSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSAS 2120

Query: 468  ADLSSSDTRFFSASTLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNS 289
            A  S+S +   S S   + + +     +TS +   +  AS    T     A     A  S
Sbjct: 2121 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 2180

Query: 288  STVVTVPSYSEPSFTSSSLIALAACSAAGASANTRTEGRTPVNAT 154
            ++     S SE + TS+S    +A ++A ASA+T        +A+
Sbjct: 2181 TSASASTSASESASTSAS---ASASTSASASASTSASASASTSAS 2222

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 103/345 (29%), Positives = 165/345 (46%), Gaps = 20/345 (5%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+SV         ++   S++ + + S       ++S+S+
Sbjct: 3124 SASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASESASTSASASAST 3183

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*S-SM 772
             +S  A  S   SA ++  A+ +++ SA   T  S  AS         S S +   S S 
Sbjct: 3184 SASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASASTSASA 3243

Query: 771  RATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSAS-SITKGMSSKPGRSAR 595
             A+   ++S    AS+S  ISA S SAS +A A++  SAS SAS S +   S+    SA 
Sbjct: 3244 SASTSASASASTSASASASISA-SESASTSASASASTSASASASTSASASASTSASESAS 3302

Query: 594  TSTWPSSS-----STSTSSSSSVASAPSRSGSVIMSSDSSADASA-------------AT 469
            TS   S+S     S STS+S+S +++ S S S   S+ +S  ASA             A+
Sbjct: 3303 TSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASESASTSAS 3362

Query: 468  ADLSSSDTRFFSASTLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNS 289
            A  S+S +   S S   + + +     +TS +   +  AS    T     A     A  S
Sbjct: 3363 ASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASAS 3422

Query: 288  STVVTVPSYSEPSFTSSSLIALAACSAAGASANTRTEGRTPVNAT 154
            ++     S SE + TS+S    +A ++A ASA+T        +A+
Sbjct: 3423 TSASASTSASESASTSAS---ASASTSASASASTSASASASTSAS 3464

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 94/326 (28%), Positives = 162/326 (48%), Gaps = 1/326 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       + S+S+
Sbjct: 456  SASTSASASASTSASASASTSASAS-ASTSASESASTSASASASTSA-------SESAST 507

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++   + +++ SA   T  S+ AS         S S +   S+  
Sbjct: 508  SASASASTSASASASTSASGSASTSTSASASTSASASASTSASASASISASESASTSASE 567

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            +    TS+  + ++S    ++ S SAS +A A++  SAS SAS+ +   S+    SA TS
Sbjct: 568  SASTSTSASASTSASESASTSASASASTSASASASTSASASAST-SASASTSASESASTS 626

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRTL 412
               +S+STS S+S+S +++ S S S   S+ +SA  SA+T A  S+S +   SAST  + 
Sbjct: 627  A-SASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASE 685

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            +       +TS +   +  AS    T     A     A ++ST  +  + +  S ++S+ 
Sbjct: 686  SA------STSASASASTSASASASTSASASASTSASA-SASTSASASASTSASESASTS 738

Query: 231  IALAACSAAGASANTRTEGRTPVNAT 154
             + +A ++A ASA+T        +A+
Sbjct: 739  ASASASTSASASASTSASASASTSAS 764

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 100/328 (30%), Positives = 169/328 (51%), Gaps = 3/328 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+AS   S+S          ++   S++ + ++S       ++S+S+
Sbjct: 4074 STSASASASTSASASASTSASASASTSASASASTSASASASTSASESAS--TSASASAST 4131

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A IS   SA ++  A+ +++ SA   T  S+ AS         S S +   +S  
Sbjct: 4132 SASASASISASESASTSASASASTSASASASTSASASASTSASESASTSTSAS---ASTS 4188

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGM-SSKPGRSART 592
            A+   ++S  A AS+S   SA S SAS +A  ++  SAS SAS+ T    S+    SA  
Sbjct: 4189 ASESASTSASASASTSASASA-STSASASASTSASASASTSASASTSASESASTSASASA 4247

Query: 591  STWPS-SSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLR 418
            ST  S S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  
Sbjct: 4248 STSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSA 4307

Query: 417  TLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSS 238
            + +       +TS +   +  AS    T     A     A ++ST  +V + +  S ++S
Sbjct: 4308 SESA------STSASASASTSASASASTSASASASTSASA-SASTSASVSASTSASESAS 4360

Query: 237  SLIALAACSAAGASANTRTEGRTPVNAT 154
            +  + +A ++A ASA+T        +A+
Sbjct: 4361 TSASASASTSASASASTSASESASTSAS 4388

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 97/331 (29%), Positives = 166/331 (49%), Gaps = 6/331 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 1164 SASTSASASASTSASASASTSASAS---TSASESASTSASASASTSA-------SASAST 1213

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S+ AS         S S +   +S  
Sbjct: 1214 SASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASES---ASTS 1270

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSAS---SITKGMSSKPGRSA 598
            A+   ++S  A AS+S   SA S SAS +A  ++ +SAS SAS   S +   S+    SA
Sbjct: 1271 ASASASTSASASASTSASASA-STSASASASTSASVSASTSASESASTSASASASTSASA 1329

Query: 597  RTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAA---TADLSSSDTRFFSAS 427
              ST  +S S STS+S+S +++ S S S   S+ +S  ASA+   +A  S+S +   SAS
Sbjct: 1330 SAST-SASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 1388

Query: 426  TLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSF 247
            T  + +       +TS +   +  AS    T         + + ++ST  +  + +  S 
Sbjct: 1389 TSASASA------STSASASASTSASASAST---------SASASASTSASASASTSASA 1433

Query: 246  TSSSLIALAACSAAGASANTRTEGRTPVNAT 154
            ++S+  + +A ++A ASA+T       ++A+
Sbjct: 1434 SASTSASASASTSASASASTSASASASISAS 1464

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 97/331 (29%), Positives = 166/331 (49%), Gaps = 6/331 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 3650 SASTSASASASTSASASASTSASAS---TSASESASTSASASASTSA-------SASAST 3699

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA   T  S+ AS         S S +   +S  
Sbjct: 3700 SASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASES---ASTS 3756

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSAS---SITKGMSSKPGRSA 598
            A+   ++S  A AS+S   SA S SAS +A  ++ +SAS SAS   S +   S+    SA
Sbjct: 3757 ASASASTSASASASTSASASA-STSASASASTSASVSASTSASESASTSASASASTSASA 3815

Query: 597  RTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAA---TADLSSSDTRFFSAS 427
              ST  +S S STS+S+S +++ S S S   S+ +S  ASA+   +A  S+S +   SAS
Sbjct: 3816 SAST-SASESASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASAS 3874

Query: 426  TLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSF 247
            T  + +       +TS +   +  AS    T         + + ++ST  +  + +  S 
Sbjct: 3875 TSASASA------STSASASASTSASASAST---------SASASASTSASASASTSASA 3919

Query: 246  TSSSLIALAACSAAGASANTRTEGRTPVNAT 154
            ++S+  + +A ++A ASA+T       ++A+
Sbjct: 3920 SASTSASASASTSASASASTSASASASISAS 3950

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 94/326 (28%), Positives = 162/326 (48%), Gaps = 1/326 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       + S+S+
Sbjct: 2942 SASTSASASASTSASASASTSASAS-ASTSASESASTSASASASTSA-------SESAST 2993

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++   + +++ SA   T  S+ AS         S S +   S+  
Sbjct: 2994 SASASASTSASASASTSASGSASTSTSASASTSASASASTSASASASISASESASTSASE 3053

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            +    TS+  + ++S    ++ S SAS +A A++  SAS SAS+ +   S+    SA TS
Sbjct: 3054 SASTSTSASASTSASESASTSASASASTSASASASTSASASAST-SASASTSASESASTS 3112

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRTL 412
               +S+STS S+S+S +++ S S S   S+ +SA  SA+T A  S+S +   SAST  + 
Sbjct: 3113 A-SASASTSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASE 3171

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            +       +TS +   +  AS    T     A     A ++ST  +  + +  S ++S+ 
Sbjct: 3172 SA------STSASASASTSASASASTSASASASTSASA-SASTSASASASTSASESASTS 3224

Query: 231  IALAACSAAGASANTRTEGRTPVNAT 154
             + +A ++A ASA+T        +A+
Sbjct: 3225 ASASASTSASASASTSASASASTSAS 3250

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 89/326 (27%), Positives = 167/326 (50%), Gaps = 1/326 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 432  SASTSASASASTSASASASTSAS---------ESASTSASASASTSASA-----SASTSA 477

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S     S+  S  ++  A+ ++++SA      S+  S         S S +T  +S  
Sbjct: 478  SASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASGSASTS-TSAS 536

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            A+   ++S    AS+S  ISA   +++ A+ +AS  +++ +++S ++  S+    SA TS
Sbjct: 537  ASTSASASASTSASASASISASESASTSASESASTSTSASASTSASESASTSASASASTS 596

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRTL 412
               +S+S STS+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  + 
Sbjct: 597  ---ASASASTSASASASTSASASTSASESASTSASASASTSASASASTSASASASTSASA 653

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            +       +TS +   +  AS    T     A   + + ++ST  +  + +  S ++S+ 
Sbjct: 654  SA------STSASVSASTSASASASTSASASA-STSASESASTSASASASTSASASASTS 706

Query: 231  IALAACSAAGASANTRTEGRTPVNAT 154
             + +A ++A ASA+T        +A+
Sbjct: 707  ASASASTSASASASTSASASASTSAS 732

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 91/331 (27%), Positives = 163/331 (48%), Gaps = 6/331 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +ST A   +       ++S+S+
Sbjct: 4278 SASTSASASASTSASASASTSASAS-----ASTSASESASTSASASAS-----TSASASA 4327

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA      S+ AS         S S +   S+  
Sbjct: 4328 STSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASESASTSA 4387

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            +    TS+  + ++S+   ++ S SAS +  A++  S S SAS+ T   +S    ++ ++
Sbjct: 4388 SASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASA 4447

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASA-----ATADLSSSDTRFFSAST 424
            +  +S+S STS+S+S +++ S S S   S+ +S  ASA     A+A  S+S +   S S 
Sbjct: 4448 STSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASISA 4507

Query: 423  LRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFT 244
              + + +     +TS +   +  AS+   T     A   T A  S+++    S S  +  
Sbjct: 4508 SESASTSASASASTSASASASTSASVSASTS--ASASASTSASASASISASESASTSASA 4565

Query: 243  SSSLIALAACS-AAGASANTRTEGRTPVNAT 154
            S+S  A A+ S +A ASA+T       ++A+
Sbjct: 4566 SASTSASASASTSASASASTSASASASISAS 4596

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 91/331 (27%), Positives = 163/331 (48%), Gaps = 6/331 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +ST A   +       ++S+S+
Sbjct: 1234 SASTSASASASTSASASASTSASAS-----ASTSASESASTSASASAS-----TSASASA 1283

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA      S+ AS         S S +   S+  
Sbjct: 1284 STSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASESASTSA 1343

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            +    TS+  + ++S+   ++ S SAS +  A++  S S SAS+ T   +S    ++ ++
Sbjct: 1344 SASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASA 1403

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASA-----ATADLSSSDTRFFSAST 424
            +  +S+S STS+S+S +++ S S S   S+ +S  ASA     A+A  S+S +   S S 
Sbjct: 1404 STSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASISA 1463

Query: 423  LRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFT 244
              + + +     +TS +   +  AS+   T     A   T A  S+++    S S  +  
Sbjct: 1464 SESASTSASASASTSASASASTSASVSASTS--ASASASTSASASASISASESASTSASA 1521

Query: 243  SSSLIALAACS-AAGASANTRTEGRTPVNAT 154
            S+S  A A+ S +A ASA+T       ++A+
Sbjct: 1522 SASTSASASASTSASASASTSASASASISAS 1552

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 91/331 (27%), Positives = 163/331 (48%), Gaps = 6/331 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +ST A   +       ++S+S+
Sbjct: 3720 SASTSASASASTSASASASTSASAS-----ASTSASESASTSASASAS-----TSASASA 3769

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA      S+ AS         S S +   S+  
Sbjct: 3770 STSASASASTSASASASTSASVSASTSASESASTSASASASTSASASASTSASESASTSA 3829

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            +    TS+  + ++S+   ++ S SAS +  A++  S S SAS+ T   +S    ++ ++
Sbjct: 3830 SASASTSASESASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASA 3889

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASA-----ATADLSSSDTRFFSAST 424
            +  +S+S STS+S+S +++ S S S   S+ +S  ASA     A+A  S+S +   S S 
Sbjct: 3890 STSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASISA 3949

Query: 423  LRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFT 244
              + + +     +TS +   +  AS+   T     A   T A  S+++    S S  +  
Sbjct: 3950 SESASTSASASASTSASASASTSASVSASTS--ASASASTSASASASISASESASTSASA 4007

Query: 243  SSSLIALAACS-AAGASANTRTEGRTPVNAT 154
            S+S  A A+ S +A ASA+T       ++A+
Sbjct: 4008 SASTSASASASTSASASASTSASASASISAS 4038

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 94/331 (28%), Positives = 163/331 (48%), Gaps = 6/331 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKW-VRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSS 952
            S+S+S+S+S+S +A+ASA TS+S    +      ST    S    T +       ++S S
Sbjct: 1764 SASTSASASASTSASASASTSASASASISASESASTSASESASTSTSASA---STSASES 1820

Query: 951  SGSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSM 772
            + +S  A  S   SA ++  A+ +++ SA   T  S  AS         S S +   +S 
Sbjct: 1821 ASTSASASASTSASASASTSASASASTSASASTSASESASTSASASASTSASAS---AST 1877

Query: 771  RATLPVTSSM*AGASSS*RISAP---SRSASRAAMAASDISASMSASSITKGMSSKPGRS 601
             A+   ++S  A AS+S   SA    S SAS +A A++  SAS SAS+     +S    +
Sbjct: 1878 SASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASESASTSASA 1937

Query: 600  ARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSAST 424
            + +++  +S+STS S+S+S +++ S S S   S+ +SA  SA+T A  S+S +   SAST
Sbjct: 1938 SASTSASASASTSASASASTSASASASTSASASASTSASESASTSASASASTSASASAST 1997

Query: 423  LRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKA-PNSSTVVTVPSYSEPSF 247
              + + +     + S +   +   S          A   T A  ++ST  +  + +  S 
Sbjct: 1998 SASASASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASE 2057

Query: 246  TSSSLIALAACSAAGASANTRTEGRTPVNAT 154
            ++S+  + +A ++A ASA+T        +A+
Sbjct: 2058 SASTSASASASTSASASASTSASASASTSAS 2088

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 96/327 (29%), Positives = 161/327 (48%), Gaps = 2/327 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S S S S S+S +A+ASA TS+S               +ST A           ++S+S+
Sbjct: 384  SQSKSLSVSASQSASASASTSASAS-------------ASTSA-----------SASAST 419

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*S-SM 772
             +S  A  S  VSA ++  A+ +++ SA   T  S  AS         S S +   S S 
Sbjct: 420  SASASASTSASVSASTSASASASTSASASASTSASESASTSASASASTSASASASTSASA 479

Query: 771  RATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSART 592
             A+   + S    AS+S   SA S SAS +A A++  SAS SAS+   G +S    ++ +
Sbjct: 480  SASTSASESASTSASASASTSA-SESASTSASASASTSASASASTSASGSASTSTSASAS 538

Query: 591  STWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRT 415
            ++  +S+STS S+S+S++++ S S S   S+ +S  ASA+T A  S+S +   SAST  +
Sbjct: 539  TSASASASTSASASASISASESASTSASESASTSTSASASTSASESASTSASASASTSAS 598

Query: 414  LTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSS 235
             + +     + S +   +  AS    T     A     A ++ST  +  + +  S ++S+
Sbjct: 599  ASASTSASASASTSASASTSASESASTSASASASTSASA-SASTSASASASTSASASAST 657

Query: 234  LIALAACSAAGASANTRTEGRTPVNAT 154
              +++A ++A ASA+T        +A+
Sbjct: 658  SASVSASTSASASASTSASASASTSAS 684

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 92/302 (30%), Positives = 153/302 (50%), Gaps = 4/302 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 4446 SASTSASASASTSASASASTSASAS-ASTSASASASTSASASASTSA-------SASAST 4497

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A IS   SA ++  A+ +++ SA   T  S  AS         S S +   +S+ 
Sbjct: 4498 SASASASISASESASTSASASASTSASASASTSASVSASTSASASASTSASAS---ASIS 4554

Query: 768  ATLPVTSSM*AGASSS*RISAP---SRSASRAAMAASDISASMSASSITKGMSSKPGRSA 598
            A+   ++S  A AS+S   SA    S SAS +A A++ ISAS SAS+     +S    ++
Sbjct: 4555 ASESASTSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASAS 4614

Query: 597  RTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTL 421
             +++  +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST 
Sbjct: 4615 ASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTS 4674

Query: 420  RTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTS 241
             + +       +TS +   +  AS    T     A     A  S++V    ++S     +
Sbjct: 4675 ASASA------STSASASASTSASASASTSASASASTSASASASTSVSNSANHSNSQVGN 4728

Query: 240  SS 235
            +S
Sbjct: 4729 TS 4730

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 100/349 (28%), Positives = 166/349 (46%), Gaps = 24/349 (6%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +S  A T +       ++S+S+
Sbjct: 2502 SASTSASASASTSASASASTSASAS-ASTSASESASTSASASASTSASA---SASTSASA 2557

Query: 948  GSSTKAGISKPVSA-HSARRAA*ASAD---SAELGTFISSLASRPVRVLPFHSNSRNTP* 781
             +ST A +S   SA  SA  +A ASA    SA   T  S+ AS         S S +T  
Sbjct: 2558 SASTSASVSASTSASESASTSASASASTSASASASTSASASASTSA------SESASTSA 2611

Query: 780  SSMRATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRS 601
            S+  +T    S+  + + S+   ++ S S S +A A++  SAS S S+     +S    +
Sbjct: 2612 SASASTSASASASTSASESASTSASASASTSASASASTSASASASTSASASASASTSASA 2671

Query: 600  ARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASA---------------ATA 466
            + +++  +S+STS S+S+S++++ S S S   S+ +S  ASA               A+A
Sbjct: 2672 SASTSASASASTSASASASISASESASTSASASASASTSASASASTSASASASTSASASA 2731

Query: 465  DLSSSDTRFFSASTLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSS 286
             +S+S++   SAS   + + +     +TS +   +  AS    T     A     A  S+
Sbjct: 2732 SISASESASTSASESASTSTS--ASASTSASESASTSASASASTSASASASTSASASAST 2789

Query: 285  TVVTVPSYSEPSFTSSSLIALAACSA-----AGASANTRTEGRTPVNAT 154
            +     S SE + TS+S  A  + SA     A ASA+T        +A+
Sbjct: 2790 SASASTSASESASTSASASASTSASASASTSASASASTSASASASTSAS 2838

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 97/326 (29%), Positives = 168/326 (50%), Gaps = 1/326 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ SA TS+S          ++   S++ + + S       ++S+S+
Sbjct: 2272 SASTSASASASTSASVSASTSASASASTSASESASTSASASASTSASESASTSASASAST 2331

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A IS   SA ++  A+ +++ SA   T  S+ AS         S S +T  +S  
Sbjct: 2332 SASASASISASESASTSASASASTSASASASTSASASASTSA------SESASTS-TSAS 2384

Query: 768  ATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTS 589
            A+   + S    AS+S   SA S SAS +A A++  SAS SAS+ +   S+    SA TS
Sbjct: 2385 ASTSASESASTSASASASTSA-SASASTSASASASTSASASAST-SASASTSASESASTS 2442

Query: 588  TWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRTL 412
               +S+STS S+S+S +++ S S S   S+ +SA ASA+T A  S+S +   SAST  + 
Sbjct: 2443 A-SASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASA 2501

Query: 411  TVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSL 232
            +       +TS +   +  AS    T     A   + + ++ST  +  + +  S ++S+ 
Sbjct: 2502 SA------STSASASASTSASASASTSASASA-STSASESASTSASASASTSASASASTS 2554

Query: 231  IALAACSAAGASANTRTEGRTPVNAT 154
             + +A ++A  SA+T        +A+
Sbjct: 2555 ASASASTSASVSASTSASESASTSAS 2580

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 91/328 (27%), Positives = 163/328 (48%), Gaps = 3/328 (0%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          ++  +S++ + + S       ++S+S+
Sbjct: 2762 SASTSASASASTSASASASTSASASASTSASASTSASESASTSASASAS----TSASASA 2817

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*S-SM 772
             +S  A  S   SA ++  A+ +++ SA +    S+ AS         S S +   S S 
Sbjct: 2818 STSASASASTSASASASTSASASASTSASVSASTSASASASTSASASASTSASESASTSA 2877

Query: 771  RATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSART 592
             A+   + S    AS+S   SA S SAS +A A++  SAS SAS+     +S    ++ +
Sbjct: 2878 SASTSASESASTSASASASTSA-SASASTSASASASTSASESASTSASASASTSASASAS 2936

Query: 591  STWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDTRFFSASTLRT 415
            ++   S+STS S+S+S +++ S S S   S+ +SA  SA+T A  S+S +   SAST  +
Sbjct: 2937 TSASESASTSASASASTSASASASTSASASASTSASESASTSASASASTSASESASTSAS 2996

Query: 414  LTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPSYS-EPSFTSS 238
             + +     + S +   +   S          A   T A  S+++    S S   S ++S
Sbjct: 2997 ASASTSASASASTSASGSASTSTSASASTSASASASTSASASASISASESASTSASESAS 3056

Query: 237  SLIALAACSAAGASANTRTEGRTPVNAT 154
            +  + +A ++A  SA+T        +A+
Sbjct: 3057 TSTSASASTSASESASTSASASASTSAS 3084

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 101/337 (29%), Positives = 161/337 (46%), Gaps = 12/337 (3%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+S          S    +ST A   +       ++S+S+
Sbjct: 4422 SASTSASASASTSASASASTSASAS-----ASTSASASASTSASASAS-----TSASASA 4471

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*S--- 778
             +S  A  S   SA ++  A+ +++ SA     IS+  S         S S +   S   
Sbjct: 4472 STSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASASASTSA 4531

Query: 777  SMRATLPVTSSM*AGASSS*RISAP-------SRSASRAAMAASDISASMSAS-SITKGM 622
            S+ A+   ++S    AS+S  ISA        S SAS +A A++  SAS SAS S +   
Sbjct: 4532 SVSASTSASASASTSASASASISASESASTSASASASTSASASASTSASASASTSASASA 4591

Query: 621  SSKPGRSARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAAT-ADLSSSDT 445
            S     SA TS   S+S+++++S+S+ ASA S S S   S+ +SA ASA+T A  S+S +
Sbjct: 4592 SISASESASTSASASASTSASASASTSASA-SASTSASASASTSASASASTSASASASTS 4650

Query: 444  RFFSASTLRTLTVTFWPG*TTSLAFLVNPDASLEMCTRPLVLAPKFTKAPNSSTVVTVPS 265
               SAST  + +       +TS +   +  AS    T              S++  T  S
Sbjct: 4651 ASASASTSASASA------STSASASASTSASASASTSA------------SASASTSAS 4692

Query: 264  YSEPSFTSSSLIALAACSAAGASANTRTEGRTPVNAT 154
             S  +  S+S    A+ SA+ + +N+     + V  T
Sbjct: 4693 ASASTSASASASTSASASASTSVSNSANHSNSQVGNT 4729

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 76/235 (32%), Positives = 119/235 (50%), Gaps = 7/235 (2%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S+S+S +A+ASA TS+SV         S    +ST A   +      +++S S+
Sbjct: 4510 SASTSASASASTSASASASTSASVS-----ASTSASASASTSASASAS-----ISASESA 4559

Query: 948  GSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSLASRPVRVLPFHSNSRNTP*SSMR 769
             +S  A  S   SA ++  A+ +++ SA     IS+  S         S S +   +S  
Sbjct: 4560 STSASASASTSASASASTSASASASTSASASASISASESASTSASASASTSASAS-ASTS 4618

Query: 768  ATLPVTSSM*AGASSS*RISAP---SRSASRAAMAASDISASMSAS-SITKGMSSKPGRS 601
            A+   ++S  A AS+S   SA    S SAS +A A++  SAS SAS S +   S+    S
Sbjct: 4619 ASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASASASTSASAS 4678

Query: 600  ARTSTWPSSS---STSTSSSSSVASAPSRSGSVIMSSDSSADASAATADLSSSDT 445
            A TS   S+S   S S S+S+S +++ S S S   S  +SA+ S +    +S  T
Sbjct: 4679 ASTSASASASTSASASASTSASASASTSASASASTSVSNSANHSNSQVGNTSGST 4733

 Score = 73.6 bits (179), Expect = 6e-12
 Identities = 89/307 (28%), Positives = 139/307 (44%), Gaps = 24/307 (7%)
 Frame = -1

Query: 1002 AGTDSPGW*YF-----LTSSSSSGSSTKAGISKPVSAHSARRAA*ASADSAELGTFISSL 838
            A TD  G  YF     +  SS++  S     S  VSA  +  A+ +++ SA   T  S+ 
Sbjct: 357  ARTDRIGINYFNGGGKVVESSTTSQSLSQSKSLSVSASQSASASASTSASASASTSASAS 416

Query: 837  ASRPVRVLPFHSNSRNTP*S-SMRATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDI 661
            AS         S S +   S S  A+   ++S    AS S   SA S SAS +A A++  
Sbjct: 417  ASTSASASASTSASVSASTSASASASTSASASASTSASESASTSA-SASASTSASASAST 475

Query: 660  SASMSASSITKGMSSKPGRSARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADA 481
            SAS SAS+     +S    ++ +++   S+STS S+S+S +++ S S S   S+ +S  A
Sbjct: 476  SASASASTSASESASTSASASASTSASESASTSASASASTSASASASTSASGSASTSTSA 535

Query: 480  SAAT-------------ADLSSSDTRFFSASTLRTLTVTFWPG*TTSLAFLVNPDASLEM 340
            SA+T             A +S+S++   SAS   + + +     +TS +   +  AS   
Sbjct: 536  SASTSASASASTSASASASISASESASTSASESASTSTS--ASASTSASESASTSASASA 593

Query: 339  CTRPLVLAPKFTKAPNSSTVVTVPSYSEPSFTSSSLIALAACSA-----AGASANTRTEG 175
             T     A     A  S++     S SE + TS+S  A  + SA     A ASA+T    
Sbjct: 594  STSASASASTSASASASTSASASTSASESASTSASASASTSASASASTSASASASTSASA 653

Query: 174  RTPVNAT 154
                +A+
Sbjct: 654  SASTSAS 660

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 73/240 (30%), Positives = 120/240 (49%), Gaps = 4/240 (1%)
 Frame = -1

Query: 1128 SSSSSSSSSSS*AATASADTSSSVKWVRLMPRPSTRLDSSTKAGTDSPGW*YFLTSSSSS 949
            S+S+S+S S+S +A+ASA TS+S     +    S    +S  A T +       ++S+S+
Sbjct: 4526 SASTSASVSASTSASASASTSASAS-ASISASESASTSASASASTSASA---SASTSASA 4581

Query: 948  GSSTKAGISKPVSA-HSARRAA*ASAD---SAELGTFISSLASRPVRVLPFHSNSRNTP* 781
             +ST A  S  +SA  SA  +A ASA    SA   T  S+ AS         S S +   
Sbjct: 4582 SASTSASASASISASESASTSASASASTSASASASTSASASASTSASASASTSASAS--- 4638

Query: 780  SSMRATLPVTSSM*AGASSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRS 601
            +S  A+   ++S  A AS+S      S SAS +A A++  SAS SAS+     +S    +
Sbjct: 4639 ASTSASASASTSASASASTS-----ASASASTSASASASTSASASASTSASASASTSASA 4693

Query: 600  ARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSASTL 421
            + +++  +S+STS S+S+S + + S + S     ++S     +  +L ++ T     S L
Sbjct: 4694 SASTSASASASTSASASASTSVSNSANHSNSQVGNTSGSTGKSQKELPNTGTESSIGSVL 4753

 Score = 36.6 bits (83), Expect = 0.82
 Identities = 25/73 (34%), Positives = 40/73 (54%)
 Frame = -1

Query: 660 SASMSASSITKGMSSKPGRSARTSTWPSSSSTSTSSSSSVASAPSRSGSVIMSSDSSADA 481
           SAS ++ S ++  S+    SA TS   +S+STS S S+S +++ S S S  +    +A A
Sbjct: 73  SASSTSLSASESASTSASESASTSA-STSASTSASESASTSASTSISASSTVVGSQTAAA 131

Query: 480 SAATADLSSSDTR 442
           + ATA     D +
Sbjct: 132 TEATAKKVEEDRK 144

 Score = 35.4 bits (80), Expect = 1.8
 Identities = 31/106 (29%), Positives = 52/106 (48%)
 Frame = -1

Query: 729 SSS*RISAPSRSASRAAMAASDISASMSASSITKGMSSKPGRSARTSTWPSSSSTSTSSS 550
           S+S   S+ S SAS +A  ++  SAS SAS+     S+    SA TS   S S++ST   
Sbjct: 69  STSNSASSTSLSASESASTSASESASTSAST---SASTSASESASTSASTSISASSTVVG 125

Query: 549 SSVASAPSRSGSVIMSSDSSADASAATADLSSSDTRFFSASTLRTL 412
           S  A+A   +   +   D    AS   A +++ + + ++    R++
Sbjct: 126 SQTAAATEATAKKV-EEDRKKPASDYVASVTNVNLQSYAKRRKRSV 170

>gb|AAK95470.1| LF3 [cercopithicine herpesvirus 15]
          Length = 890

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 122/394 (30%), Positives = 143/394 (35%), Gaps = 52/394 (13%)
 Frame = -2

Query: 1124 PRPRRPPAP------RRQQQPQPTPPRQ*SGSG*CRGRQPGSTPARKRA-------PTRR 984
            PR  RPPAP      R +Q+P   PP + SG    R   P S   ++         P R 
Sbjct: 179  PRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERG 238

Query: 983  AGSTS*RPAR--HRAAPRRRASQSRCPPTRRAERPEPQRTARSWAPSSRPW--------- 837
            +G    RP     R   R R      PP    ER    R  R  APSSR           
Sbjct: 239  SGPRGTRPPAPSSRTGQRTRQRPGHPPP----ERGSGPRGTRPPAPSSRTGQRTRQRPGH 294

Query: 836  -PADRSGSCRSTRTPG--------TRRSPQCGPPCRSPPPCRRGPPARSG-----SRHRP 699
             P +R    R TR P         TR+ P   PP R   P    PPA S      +R RP
Sbjct: 295  PPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRP 354

Query: 698  GQPPGQRWPPPTSRRPCPPPPSRRECPQSRAGQRGPPPGRPPAP----PPHPRR---HRW 540
            G PP +R   P   R  PP PS R   ++R     PPP R   P    PP P      R 
Sbjct: 355  GHPPPERGSGPRGTR--PPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT 412

Query: 539  HQRPRGQAR**CHPTPQPTPQQR-QRT*APATRA---SSQRPRSGP*RSPSGQAEPRPWR 372
             QRP        HP P+     R  R  AP++R    + QRP   P    SG    RP  
Sbjct: 413  RQRPG-------HPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPA 465

Query: 371  SW*TQTPAWKCAPGRWCWRRSS--RKRRTPRRSSRC-PRTQSPPSRPPA**PWRPARQRA 201
                     +  PG     R S  R  R P  SSR   RT+  P  PP            
Sbjct: 466  PSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPP------------ 513

Query: 200  PQRTHGPKAGHR*TPPGACQPARARGAERCGHGP 99
            P+R  GP+      PP        R  +R GH P
Sbjct: 514  PERGSGPRGTR---PPAPSSRTGQRTRQRPGHPP 544

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 122/394 (30%), Positives = 143/394 (35%), Gaps = 52/394 (13%)
 Frame = -2

Query: 1124 PRPRRPPAP------RRQQQPQPTPPRQ*SGSG*CRGRQPGSTPARKRA-------PTRR 984
            PR  RPPAP      R +Q+P   PP + SG    R   P S   ++         P R 
Sbjct: 334  PRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERG 393

Query: 983  AGSTS*RPAR--HRAAPRRRASQSRCPPTRRAERPEPQRTARSWAPSSRPW--------- 837
            +G    RP     R   R R      PP    ER    R  R  APSSR           
Sbjct: 394  SGPRGTRPPAPSSRTGQRTRQRPGHPPP----ERGSGPRGTRPPAPSSRTGQRTRQRPGH 449

Query: 836  -PADRSGSCRSTRTPG--------TRRSPQCGPPCRSPPPCRRGPPARSG-----SRHRP 699
             P +R    R TR P         TR+ P   PP R   P    PPA S      +R RP
Sbjct: 450  PPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRP 509

Query: 698  GQPPGQRWPPPTSRRPCPPPPSRRECPQSRAGQRGPPPGRPPAP----PPHPRR---HRW 540
            G PP +R   P   R  PP PS R   ++R     PPP R   P    PP P      R 
Sbjct: 510  GHPPPERGSGPRGTR--PPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT 567

Query: 539  HQRPRGQAR**CHPTPQPTPQQR-QRT*APATRA---SSQRPRSGP*RSPSGQAEPRPWR 372
             QRP        HP P+     R  R  AP++R    + QRP   P    SG    RP  
Sbjct: 568  RQRPG-------HPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPA 620

Query: 371  SW*TQTPAWKCAPGRWCWRRSS--RKRRTPRRSSRC-PRTQSPPSRPPA**PWRPARQRA 201
                     +  PG     R S  R  R P  SSR   RT+  P  PP            
Sbjct: 621  PSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPP------------ 668

Query: 200  PQRTHGPKAGHR*TPPGACQPARARGAERCGHGP 99
            P+R  GP+      PP        R  +R GH P
Sbjct: 669  PERGSGPRGTR---PPAPSSRTGQRTRQRPGHPP 699

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 122/394 (30%), Positives = 143/394 (35%), Gaps = 52/394 (13%)
 Frame = -2

Query: 1124 PRPRRPPAP------RRQQQPQPTPPRQ*SGSG*CRGRQPGSTPARKRA-------PTRR 984
            PR  RPPAP      R +Q+P   PP + SG    R   P S   ++         P R 
Sbjct: 458  PRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERG 517

Query: 983  AGSTS*RPAR--HRAAPRRRASQSRCPPTRRAERPEPQRTARSWAPSSRPW--------- 837
            +G    RP     R   R R      PP    ER    R  R  APSSR           
Sbjct: 518  SGPRGTRPPAPSSRTGQRTRQRPGHPPP----ERGSGPRGTRPPAPSSRTGQRTRQRPGH 573

Query: 836  -PADRSGSCRSTRTPG--------TRRSPQCGPPCRSPPPCRRGPPARSG-----SRHRP 699
             P +R    R TR P         TR+ P   PP R   P    PPA S      +R RP
Sbjct: 574  PPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRP 633

Query: 698  GQPPGQRWPPPTSRRPCPPPPSRRECPQSRAGQRGPPPGRPPAP----PPHPRR---HRW 540
            G PP +R   P   R  PP PS R   ++R     PPP R   P    PP P      R 
Sbjct: 634  GHPPPERGSGPRGTR--PPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT 691

Query: 539  HQRPRGQAR**CHPTPQPTPQQR-QRT*APATRA---SSQRPRSGP*RSPSGQAEPRPWR 372
             QRP        HP P+     R  R  AP++R    + QRP   P    SG    RP  
Sbjct: 692  RQRPG-------HPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPA 744

Query: 371  SW*TQTPAWKCAPGRWCWRRSS--RKRRTPRRSSRC-PRTQSPPSRPPA**PWRPARQRA 201
                     +  PG     R S  R  R P  SSR   RT+  P  PP            
Sbjct: 745  PSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPP------------ 792

Query: 200  PQRTHGPKAGHR*TPPGACQPARARGAERCGHGP 99
            P+R  GP+      PP        R  +R GH P
Sbjct: 793  PERGSGPRGTR---PPAPSSRTGQRTRQRPGHPP 823

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 118/389 (30%), Positives = 139/389 (35%), Gaps = 46/389 (11%)
 Frame = -2

Query: 1127 APRPRRPPAPRRQQQPQPTPPRQ*SGSG*CRGRQPGSTPARKR-------APTRRAGSTS 969
            AP P      R +Q+P   PP + SG    R   P S   ++         P R +G   
Sbjct: 29   APGPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRG 88

Query: 968  *RP--ARHRAAPRRRASQSRCPPTRRAERPEPQRTARSWAPSSRPW----------PADR 825
             RP     R   R R      PP    ER    R  R  APSSR            P +R
Sbjct: 89   TRPPAPSSRTGQRTRQRPGHPPP----ERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPER 144

Query: 824  SGSCRSTRTPG--------TRRSPQCGPPCRSPPPCRRGPPARSG-----SRHRPGQPPG 684
                R TR P         TR+ P   PP R   P    PPA S      +R RPG PP 
Sbjct: 145  GSGPRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPP 204

Query: 683  QRWPPPTSRRPCPPPPSRRECPQSRAGQRGPPPGRPPAP----PPHPRR---HRWHQRPR 525
            +R   P   R  PP PS R   ++R     PPP R   P    PP P      R  QRP 
Sbjct: 205  ERGSGPRGTR--PPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPG 262

Query: 524  GQAR**CHPTPQPTPQQR-QRT*APATRA---SSQRPRSGP*RSPSGQAEPRPWRSW*TQ 357
                   HP P+     R  R  AP++R    + QRP   P    SG    RP       
Sbjct: 263  -------HPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRT 315

Query: 356  TPAWKCAPGRWCWRRSS--RKRRTPRRSSRC-PRTQSPPSRPPA**PWRPARQRAPQRTH 186
                +  PG     R S  R  R P  SSR   RT+  P  PP            P+R  
Sbjct: 316  GQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPP------------PERGS 363

Query: 185  GPKAGHR*TPPGACQPARARGAERCGHGP 99
            GP+      PP        R  +R GH P
Sbjct: 364  GPRGTR---PPAPSSRTGQRTRQRPGHPP 389

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 110/357 (30%), Positives = 133/357 (36%), Gaps = 21/357 (5%)
 Frame = -2

Query: 1106 PAPRRQQQPQPTPPRQ*SGSG*CRGRQPGSTPARKRAPTRRAGSTS*RPARHRAAPRRRA 927
            P  R Q  P P P    S +G    ++PG  P     P R +G    RP     AP  R 
Sbjct: 20   PNQRTQGHPAPGPS---SRTGQRTRQRPGHPP-----PERGSGPRGTRPP----APSSRT 67

Query: 926  SQSRCPPTRRAERPEPQRTA--RSWAPSSRPWPADRSGSCRSTRTPGTRRSPQCGPPCRS 753
             Q      +R   P P+R +  R   P   P P+ R+G         TR+ P   PP R 
Sbjct: 68   GQRT---RQRPGHPPPERGSGPRGTRP---PAPSSRTGQ-------RTRQRPGHPPPERG 114

Query: 752  PPPCRRGPPARSG-----SRHRPGQPPGQRWPPPTSRRPCPPPPSRRECPQSRAGQRGPP 588
              P    PPA S      +R RPG PP +R   P   R  PP PS R   ++R     PP
Sbjct: 115  SGPRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTR--PPAPSSRTGQRTRQRPGHPP 172

Query: 587  PGRPPAP----PPHPRR---HRWHQRPRGQAR**CHPTPQPTPQQR-QRT*APATRA--- 441
            P R   P    PP P      R  QRP        HP P+     R  R  AP++R    
Sbjct: 173  PERGSGPRGTRPPAPSSRTGQRTRQRPG-------HPPPERGSGPRGTRPPAPSSRTGQR 225

Query: 440  SSQRPRSGP*RSPSGQAEPRPWRSW*TQTPAWKCAPGRWCWRRSS--RKRRTPRRSSRC- 270
            + QRP   P    SG    RP           +  PG     R S  R  R P  SSR  
Sbjct: 226  TRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTG 285

Query: 269  PRTQSPPSRPPA**PWRPARQRAPQRTHGPKAGHR*TPPGACQPARARGAERCGHGP 99
             RT+  P  PP            P+R  GP+      PP        R  +R GH P
Sbjct: 286  QRTRQRPGHPP------------PERGSGPRGTR---PPAPSSRTGQRTRQRPGHPP 327

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 84/259 (32%), Positives = 97/259 (37%), Gaps = 45/259 (17%)
 Frame = -2

Query: 1124 PRPRRPPAP------RRQQQPQPTPPRQ*SGSG*CRGRQPGSTPARKRA-------PTRR 984
            PR  RPPAP      R +Q+P   PP + SG    R   P S   ++         P R 
Sbjct: 613  PRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERG 672

Query: 983  AGSTS*RPAR--HRAAPRRRASQSRCPPTRRAERPEPQRTARSWAPSSRPW--------- 837
            +G    RP     R   R R      PP    ER    R  R  APSSR           
Sbjct: 673  SGPRGTRPPAPSSRTGQRTRQRPGHPPP----ERGSGPRGTRPPAPSSRTGQRTRQRPGH 728

Query: 836  -PADRSGSCRSTRTPG--------TRRSPQCGPPCRSPPPCRRGPPARSG-----SRHRP 699
             P +R    R TR P         TR+ P   PP R   P    PPA S      +R RP
Sbjct: 729  PPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRP 788

Query: 698  GQPPGQRWPPPTSRRPCPPPPSRRECPQSRAGQRGPPPGRPPAP----PPHPRR---HRW 540
            G PP +R   P   R  PP PS R   ++R     PPP R   P    PP P      R 
Sbjct: 789  GHPPPERGSGPRGTR--PPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT 846

Query: 539  HQRPRGQAR**CHPTPQPT 483
             QRP        HP P+ T
Sbjct: 847  RQRPG-------HPPPEQT 858

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 73/230 (31%), Positives = 86/230 (36%), Gaps = 53/230 (23%)
 Frame = -2

Query: 1124 PRPRRPPAP------RRQQQPQPTPPRQ*SGSG*CRGRQPGSTPARKRA-------PTRR 984
            PR  RPPAP      R +Q+P   PP + SG    R   P S   ++         P R 
Sbjct: 644  PRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERG 703

Query: 983  AGSTS*RPAR--HRAAPRRRASQSRCPPTRRAERPEPQRTARSWAPSSRPW--------- 837
            +G    RP     R   R R      PP    ER    R  R  APSSR           
Sbjct: 704  SGPRGTRPPAPSSRTGQRTRQRPGHPPP----ERGSGPRGTRPPAPSSRTGQRTRQRPGH 759

Query: 836  -PADRSGSCRSTRTPG--------TRRSPQCGPPCRSPPPCRRGPPARSG-----SRHRP 699
             P +R    R TR P         TR+ P   PP R   P    PPA S      +R RP
Sbjct: 760  PPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRP 819

Query: 698  GQPP--------GQRWPPPTSR-------RPCPPPPSRRECPQSRAGQRG 594
            G PP        G R P P+SR       RP  PPP + +      G+RG
Sbjct: 820  GHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGHPPPEQTQ----TLGKRG 865



EST assemble image


clone accession position
1 MXL085d05_r BP098016 1 451
2 HCL085a06_r AV644263 5 583
3 LCL008b02_r AV626377 56 472
4 LCL051a05_r AV629054 62 574
5 HCL087a12_r AV644362 70 485
6 HCL024f07_r AV640918 73 472
7 HCL038c08_r AV641660 80 574
8 CL07f05_r AV393491 80 492
9 MXL064f02_r BP096770 91 571
10 HCL027e02_r AV641084 97 558
11 MXL092e03_r BP098380 146 518
12 MXL021b12_r BP094321 175 482
13 CL71c06_r AV396890 219 743
14 HCL077f01_r AV643879 412 702
15 HCL097b11_r AV645030 583 942
16 HCL072d08_r AV643594 587 1092
17 HCL031f09_r AV641326 628 1141
18 MXL093a02_r BP098414 655 1045
19 LCL086a05_r AV630899 658 1092
20 MXL100b05_r BP098849 664 1039




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research