KCC000162A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000162A_C01 KCC000162A_c01
CCCCCTGCAAGTGTGCACTAGCACTGTCAGCGCAGTCTGGCAGGATTCGTAGCCATGCTT
GGGGCATGATGTTGTTTGTTTTTACTGTCATGAAGCAGCACCGCAAGAGCTGCATTTGGT
CCCTAAGGCAGCCACCTCCTTGTTACTGTCATGGGTTTTGGTGTTGTGTGGAGGTCCTTT
CTCTCATTGCGGCGGTCGGCGACACGACGTACGGCCCGTGACTGTGCGATGGCCAAGGGC
GAGCATGCAGACTTGAGGGGTCTCCTGAGCGCTTGACAATCCGAGGGATGTATCTGCGAG
GGCGAAGAATTCTGATCGTGTCAGACGAAGACGTTTGCAGCATTGGCGAGCTGGATGGCT
GCGGTGTAGCGTGCACAGTGCTGCCCAAGAGGTGTTGGTGTATGTTTCGGTCGGGCAAGC
TTGGGACACCATAACGGTTCAATAAAGCGACTTCCCCTGCATAAGGGGCACGTTGCCACA
ACTACTGGTCGCAGACAATGACTGTAatctgtaccgcagaaaaaaaaaaaaaaaaaaaaa
aaaaaaaaaaaaaactcgagacctggtgc


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000162A_C01 KCC000162A_c01
         (569 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAC04541.1| unnamed protein product [Homo sapiens]                 37  0.15
gb|AAL78633.1|AF468496_1 PGC-1-related estrogen receptor alpha c...    37  0.15
ref|NP_573570.2| PGC-1-related estrogen receptor alpha coactivat...    37  0.15
gb|AAO40025.1| peroxisome proliferator-activated receptor gamma ...    37  0.15
gb|AAO40023.1| peroxisome proliferator-activated receptor gamma ...    37  0.15

>dbj|BAC04541.1| unnamed protein product [Homo sapiens]
          Length = 1023

 Score = 37.4 bits (85), Expect = 0.15
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 6/68 (8%)
 Frame = -2

Query: 415 PDRNIHQHLLGSTVHATPQPSSSPMLQTSSS------DTIRILRPRRYIPRIVKRSGDPS 254
           P+R+    LL    HAT QP+S    +   S      D  ++LRP   + R V RS +PS
Sbjct: 659 PERS---ELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLRPEGVLQRKVLRSWEPS 715

Query: 253 SLHARPWP 230
            +H   WP
Sbjct: 716 GVHLEDWP 723

>gb|AAL78633.1|AF468496_1 PGC-1-related estrogen receptor alpha coactivator [Homo sapiens]
          Length = 1023

 Score = 37.4 bits (85), Expect = 0.15
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 6/68 (8%)
 Frame = -2

Query: 415 PDRNIHQHLLGSTVHATPQPSSSPMLQTSSS------DTIRILRPRRYIPRIVKRSGDPS 254
           P+R+    LL    HAT QP+S    +   S      D  ++LRP   + R V RS +PS
Sbjct: 659 PERS---ELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLRPEGVLQRKVLRSWEPS 715

Query: 253 SLHARPWP 230
            +H   WP
Sbjct: 716 GVHLEDWP 723

>ref|NP_573570.2| PGC-1-related estrogen receptor alpha coactivator [Homo sapiens]
           gi|28412322|gb|AAO40022.1| peroxisome
           proliferator-activated receptor gamma coactivator
           1beta-1a [Homo sapiens]
          Length = 1023

 Score = 37.4 bits (85), Expect = 0.15
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 6/68 (8%)
 Frame = -2

Query: 415 PDRNIHQHLLGSTVHATPQPSSSPMLQTSSS------DTIRILRPRRYIPRIVKRSGDPS 254
           P+R+    LL    HAT QP+S    +   S      D  ++LRP   + R V RS +PS
Sbjct: 659 PERS---ELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLRPEGVLQRKVLRSWEPS 715

Query: 253 SLHARPWP 230
            +H   WP
Sbjct: 716 GVHLEDWP 723

>gb|AAO40025.1| peroxisome proliferator-activated receptor gamma coactivator
           1beta-2b [Homo sapiens]
          Length = 996

 Score = 37.4 bits (85), Expect = 0.15
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 6/68 (8%)
 Frame = -2

Query: 415 PDRNIHQHLLGSTVHATPQPSSSPMLQTSSS------DTIRILRPRRYIPRIVKRSGDPS 254
           P+R+    LL    HAT QP+S    +   S      D  ++LRP   + R V RS +PS
Sbjct: 638 PERS---ELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLRPEGVLQRKVLRSWEPS 694

Query: 253 SLHARPWP 230
            +H   WP
Sbjct: 695 GVHLEDWP 702

>gb|AAO40023.1| peroxisome proliferator-activated receptor gamma coactivator
           1beta-1b [Homo sapiens]
          Length = 1017

 Score = 37.4 bits (85), Expect = 0.15
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 6/68 (8%)
 Frame = -2

Query: 415 PDRNIHQHLLGSTVHATPQPSSSPMLQTSSS------DTIRILRPRRYIPRIVKRSGDPS 254
           P+R+    LL    HAT QP+S    +   S      D  ++LRP   + R V RS +PS
Sbjct: 659 PERS---ELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLRPEGVLQRKVLRSWEPS 715

Query: 253 SLHARPWP 230
            +H   WP
Sbjct: 716 GVHLEDWP 723



EST assemble image


clone accession position
1 CM073c12_r AV391407 1 604
2 CL07f04_r AV393450 119 541




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research