KCC000161A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000161A_C01 KCC000161A_c01
cacgcgcctctgtgaacttgtgactgactggtcgggctgctgggcagccggcttcacgac
ttgtcaagggtgcttcttgtAGTGCATTTATTCATGTACTCGGAACACAGCAAGTGTATT
ACTCTCCGTAGCAGATATGCGCACCTTAACAAAGAGTTAGGAAGGAGGCCACTGTCTCCT
GCGACGTAGCTCAGTCACCAAGAGCATCCTCGCGCCACTTTGATAGCTGCAGACCAGAAG
ATATGGAGGAATATGGAGGGGCGCCTGGCGCCTGCCGGGTTGAGCCCATTCAGGGAGGCC
CGCAGGGTGGCTCTGGCCGCGCCGGCGAGCGGGTGGAGGATGTGTTCAGCTGCGTGCTAC
CCTACCTTGCTCCAGCTGACCGCGTTTCACTCCGGGGCTGTCTCCGCACCTTTAAGGAAC
ATGGCAAACCGGAGCACAACCCGCGTGTCGCTGTGCGGGACCGCAGTGCTGCACGCGCTT
GGCAGCTCCCAGCTATTGAAGCGTTTCCCACGGCTGTCGTCTCTGGACTTCACTCTTGGC
AGTCCGGCGGAGGGCAAGCAGGCGACGCTGGCGCTACTCACTCAGCCCGACCAGCAGAGC
TCGCAGCTGGCGAGACTCACCTGGAACGAGAACCGAATCGCCGCCCAGCAGCTACACCAG
CAACAAAATTCCACGGGCGGATATGGGCAGCAGTCTGAGTCCAGGTATCAGCACTACAAT
GCAAGCGGGAGCCGCTCCAGCCCGGCCACTTTCGACTTCACCGAGTCGATTCTGGCTGCG
GTATGTAGCGGTGCACCCGTCAAGTCCGTCAGCGTCGACAAAACCGCGCTGCTGGAGACG
GAGGCTGCTGCGATTGCCCGCATGACCGCGCTCGAGGAGTTGCGGCTTGCGACTAACTCG
TCTGCACAGCCGCTGAGGCGCCCGCTGGTGCAGCTTATGCTGGGGAACATGCGGAACCTG
CGGGTGCTCAAGCTGTCTTACATCCGCGACACCACGGCCGACATGGTGCTCAGCCTCCCA
CGGCTACCAAACCTGTCGAAGCTCATCCTGCA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000161A_C01 KCC000161A_c01
         (1052 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_170658.1| similar to hypothetical protein [Homo sapiens]        41  0.040
ref|ZP_00090616.1| COG0392: Predicted integral membrane protein ...    41  0.040
pir||S18946 ultra high-sulfur keratin 1 - human gi|32472|emb|CAA...    40  0.067
ref|NP_005544.1| keratin, cuticle, ultrahigh sulphur 1; Keratin,...    40  0.067
ref|ZP_00013467.1| hypothetical protein [Rhodospirillum rubrum]        40  0.067

>ref|XP_170658.1| similar to hypothetical protein [Homo sapiens]
          Length = 1523

 Score = 40.8 bits (94), Expect = 0.040
 Identities = 44/158 (27%), Positives = 59/158 (36%), Gaps = 23/158 (14%)
 Frame = +3

Query: 162 KEATVSCDVAQSPRASSRHFDSCRPEDMEEYGGAPGA-CRVEPIQGGPQGGSGRAGERVE 338
           +E++  C V    R+  RH D+  PE     G  P A CR  P +  P+G  GR G R  
Sbjct: 416 EESSAVCQVDAEQRSKVRHVDTKGPEAT---GVMPEARCRGTP-EAPPRGSQGRLGVRTR 471

Query: 339 DVF--SCVLPYLAPADRVSLRGCLRTFK------------EHGKP-------EHNPRV-A 452
           D       LP   PA      G L   +              G P       E  P V A
Sbjct: 472 DEAPSGLSLPPAEPAGHSGQLGDLEGARAAAGQEREGAEVRGGAPGIEGTGLEQGPSVGA 531

Query: 453 VRDRSAARAWQLPAIEAFPTAVVSGLHSWQSGGGQAGD 566
           +  R    +WQ   +     A+  GL  W++  G +GD
Sbjct: 532 ISTRPQVSSWQGALLSTAQGAISRGLGGWEAEAGGSGD 569

>ref|ZP_00090616.1| COG0392: Predicted integral membrane protein [Azotobacter
           vinelandii]
          Length = 553

 Score = 40.8 bits (94), Expect = 0.040
 Identities = 33/84 (39%), Positives = 41/84 (48%), Gaps = 3/84 (3%)
 Frame = -3

Query: 489 GAAKRVQHCGPAQRHAGCAPVCHVP*RCGDSPGVKRGQLEQGRVARS*THPP--PARRRG 316
           GA +  +   P QRH G  P  H P   G SP   R +L   R++ +  +PP   ARRRG
Sbjct: 25  GAVRHPRQPQPHQRHRGAVPGSHPP---GASPAGDRQRLFLPRLSPAAGNPPRRAARRRG 81

Query: 315 QSHPAGLPEWAQPGRRQAP-LHIP 247
            + PAG    A    R AP L IP
Sbjct: 82  GADPAGPAGHADRQIRCAPVLRIP 105

>pir||S18946 ultra high-sulfur keratin 1 - human gi|32472|emb|CAA45283.1|
            high-sulpher keratin [Homo sapiens]
          Length = 169

 Score = 40.0 bits (92), Expect = 0.067
 Identities = 19/48 (39%), Positives = 25/48 (51%), Gaps = 3/48 (6%)
 Frame = +2

Query: 917  GARWCSLCWGT---CGTCGCSSCLTSATPRPTWCSASHGYQTCRSSSC 1051
            G R C  C G+   CG+CGCS C   +  +P  CS+  G   C+ S C
Sbjct: 58   GKRGCGSCGGSKGGCGSCGCSQC---SCCKPCCCSSGCGSSCCQCSCC 102

>ref|NP_005544.1| keratin, cuticle, ultrahigh sulphur 1; Keratin, hair cuticle,
            ultrahigh-sulfur, 1 [Homo sapiens]
            gi|125681|sp|P26371|KRUA_HUMAN Keratin, ultra high-sulfur
            matrix protein A (UHS keratin A) (UHS KerA)
            gi|34079|emb|CAA39005.1| ultra high-sulphur keratin
            protein [Homo sapiens] gi|3228239|emb|CAA07189.1| ultra
            high sulfer keratin [Homo sapiens]
            gi|227473|prf||1704255A Cys rich protein
          Length = 169

 Score = 40.0 bits (92), Expect = 0.067
 Identities = 19/48 (39%), Positives = 25/48 (51%), Gaps = 3/48 (6%)
 Frame = +2

Query: 917  GARWCSLCWGT---CGTCGCSSCLTSATPRPTWCSASHGYQTCRSSSC 1051
            G R C  C G+   CG+CGCS C   +  +P  CS+  G   C+ S C
Sbjct: 58   GKRGCGSCGGSKGGCGSCGCSQC---SCCKPCCCSSGCGSSCCQCSCC 102

>ref|ZP_00013467.1| hypothetical protein [Rhodospirillum rubrum]
          Length = 487

 Score = 40.0 bits (92), Expect = 0.067
 Identities = 40/140 (28%), Positives = 65/140 (45%), Gaps = 9/140 (6%)
 Frame = +1

Query: 526 DFTLGSPAEGKQATLALLTQPDQQSSQLARLTWNEN--RIAAQQLHQQQNSTGGYGQQSE 699
           DF+L  PA G  ATL  +T     + ++ +L + +   R +   LH    +  G      
Sbjct: 169 DFSLSVPATGVNATLGKMTLEGITAGRMGKLAYEDYDLRTSDGMLHMGSLALDGLDLSRA 228

Query: 700 SRY-QHYNASGSRSSPATFDF--TESILA-AVCSGAPVKSVSVDKTAL--LETEAAAIAR 861
            R+ Q   A  +R  P TFD     SI A  +   +  +SV++D+ AL  LE++   + R
Sbjct: 229 LRWAQQTQAQQARGEPPTFDVLGLRSIEAKGLALTSRERSVALDRFALADLESDRGMLVR 288

Query: 862 MT-ALEELRLATNSSAQPLR 918
            T A+E  ++     A+P R
Sbjct: 289 ATLAVEGFQVPAAQVAEPTR 308



EST assemble image


clone accession position
1 MXL029f05_r BP094784 1 229
2 LCL020a08_r AV627028 100 583
3 LCL087h10_r AV631037 100 542
4 HCL067f07_r AV643328 101 557
5 MXL046f06_r BP095739 105 494
6 MXL099f09_r BP098819 106 480
7 MXL097a12_r BP098662 111 576
8 CL78f02_r AV397220 111 638
9 LCL085a08_r AV630842 118 374
10 HCL037g01_r AV641626 131 469
11 HCL080c08_r AV644018 133 648
12 CL07f02_r AV393473 133 634
13 HCL054b07_r AV642577 133 590
14 HCL068a09_r AV643347 139 500
15 CL07g01_r AV393489 139 634
16 HCL011g11_r AV640186 141 561
17 LCL038g08_r AV628232 145 311
18 LCL059a08_r AV629455 162 682
19 HCL050h05_r AV642382 170 632
20 LCL051g04_r AV629083 209 724
21 MXL030e08_r BP094831 249 440
22 LCL034a12_r AV627931 287 576
23 CL46g08_r AV395635 291 774
24 LCL064b06_r AV629707 391 840
25 HCL055a02_r AV642625 563 1059




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research