KCC000159A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000159A_C01 KCC000159A_c01
GCGATTGCAAATGATTTTAAATCTTGGATTGTCTTCTCAAGCGATCACTCCCTCCCGTGG
GAGACGCCACGCGGGAGAGACTGGACACTGCACCCGACACCCTTGACTGCGAAAGCGCCC
GAGACAGCAAAAGACCCAAACGGCCAGCATTGCTATTGCGTCTCCCAATGCCACGTGCTT
GCTGCTTCGCCTCATTGACGAGGACGGCGTTCCGCTGGTCGCAGGCACGACATGCCGCGA
AAATTGTACACAGCCCTAACACGAAACACACATCGAGAAAGCCCCCAGACTAGCGCGTGC
AGATTGCTCTGCCCCGCACAATGCTGAAAGGCTCACAGCAGCTGCGAGCGCCCTCAGCCG
CGCAGCACAGAAGTCCACTGCTAAACTCCAAGTGCTGCTGCTGGAGCGGCAACGGTCCAC
GACGTCCTCCTAGGGCCAGGGAATTCATCAGGCCGCCGCCACCTTTTGAAGTTCACCTCC
AAACCGccgagcgccagtgc


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000159A_C01 KCC000159A_c01
         (500 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|ZP_00125384.1| hypothetical protein [Pseudomonas syringae pv...    38  0.080
emb|CAC37156.2| PDZ-domain protein [Leishmania major]                  37  0.14
pir||T43481 probable mucin DKFZp434C196.1 - human (fragment) gi|...    34  1.2
ref|NP_689844.1| hypothetical protein FLJ35782 [Homo sapiens] gi...    33  2.6
ref|NP_881489.1| adhesin [Bordetella pertussis] gi|33563918|emb|...    32  3.3

>ref|ZP_00125384.1| hypothetical protein [Pseudomonas syringae pv. syringae B728a]
          Length = 255

 Score = 37.7 bits (86), Expect = 0.080
 Identities = 38/120 (31%), Positives = 52/120 (42%)
 Frame = +3

Query: 135 PKRPALLLRLPMPRACCFASLTRTAFRWSQARHAAKIVHSPNTKHTSRKPPD*RVQIALP 314
           P RP LL+ LP P       + R A   S A HAA    + N +  +R+P   RV++  P
Sbjct: 17  PSRPQLLVPLPPP-----VEVQRVAPAASPAEHAAP-AEASNVEPIARQPERPRVEV--P 68

Query: 315 RTMLKGSQQLRAPSAAQHRSPLLNSKCCCWSGNGPRRPPRAREFIRPPPPFEVHLQTAER 494
           R  L  ++   AP AA+   P                PP+A   + PPP F + L  A R
Sbjct: 69  RPSLASTR--TAPPAAEEAEP---------------APPKAP--VVPPPRFALQLLRAGR 109

>emb|CAC37156.2| PDZ-domain protein [Leishmania major]
          Length = 471

 Score = 37.0 bits (84), Expect = 0.14
 Identities = 26/82 (31%), Positives = 37/82 (44%), Gaps = 1/82 (1%)
 Frame = +3

Query: 45  SLPPVGDATRERLDTAPDTLDCESARDSKRPKRPALLLR-LPMPRACCFASLTRTAFRWS 221
           SLPP   A     +TAP  L         RP   A++ R  P+P+AC   S+   A R +
Sbjct: 254 SLPPPPSALVTTNETAPPPLPVLRQPSRARPDADAVVSRPAPLPQACVDQSMRERAVRDT 313

Query: 222 QARHAAKIVHSPNTKHTSRKPP 287
            A  + ++  S  T  T+  PP
Sbjct: 314 HAPTSMRMADSSATAATTTAPP 335

>pir||T43481 probable mucin DKFZp434C196.1 - human (fragment)
           gi|6599134|emb|CAB63715.1| hypothetical protein [Homo
           sapiens]
          Length = 580

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 31/90 (34%), Positives = 40/90 (44%)
 Frame = +3

Query: 189 ASLTRTAFRWSQARHAAKIVHSPNTKHTSRKPPD*RVQIALPRTMLKGSQQLRAPSAAQH 368
           ASLTRT  R S  R   +   SP T+   R+ P    + +  RT  + S   R P A+  
Sbjct: 174 ASLTRTPSRASLTRWPPRA--SP-TRTPPRESPRMSHRASPTRTPPRASPTRRPPRASPT 230

Query: 369 RSPLLNSKCCCWSGNGPRRPPRAREFIRPP 458
           R+P   S       +  R PPRA    RPP
Sbjct: 231 RTPPRESLRTSHRASPTRMPPRASPTRRPP 260

>ref|NP_689844.1| hypothetical protein FLJ35782 [Homo sapiens]
           gi|21751864|dbj|BAC04056.1| unnamed protein product
           [Homo sapiens]
          Length = 645

 Score = 32.7 bits (73), Expect = 2.6
 Identities = 38/135 (28%), Positives = 50/135 (36%), Gaps = 2/135 (1%)
 Frame = +1

Query: 49  SLPWETPRGRDWTLHPTPLTAKAPETAKDP--NGQHCYCVSQCHVLAASPH*RGRRSAGR 222
           SL  E P+ R  +LHP P   +A     DP   G    C      L +S H       G 
Sbjct: 222 SLRPEPPKTRVSSLHPEPPETRASHLRVDPPETGVSHLCPEPPKTLVSSVH-PEPPDTGA 280

Query: 223 RHDMPRKLYTALTRNTHRESPQTSACRLLCPAQC*KAHSSCERPQPRSTEVHC*TPSAAA 402
            H  P    T ++ + H ESP+T    L              RP+P  T+V    P    
Sbjct: 281 SHLCPEPPETRVS-HLHPESPETGVSHL--------------RPEPSKTQVSSLCPEPP- 324

Query: 403 GAATVHDVLLGPGNS 447
             A V  + L P N+
Sbjct: 325 -EAGVSHLCLEPPNT 338

>ref|NP_881489.1| adhesin [Bordetella pertussis] gi|33563918|emb|CAE43179.1| adhesin
            [Bordetella pertussis]
          Length = 4196

 Score = 32.3 bits (72), Expect = 3.3
 Identities = 22/64 (34%), Positives = 28/64 (43%)
 Frame = +3

Query: 267  HTSRKPPD*RVQIALPRTMLKGSQQLRAPSAAQHRSPLLNSKCCCWSGNGPRRPPRAREF 446
            H  R+  D  V +A+ R     S  L A  A+ H  PLL+  CC      P  PP A   
Sbjct: 3302 HAQRRQGD--VDMAVARERASLSDVLAAVEASGHHYPLLHFTCCRGETTPPGAPPDA--- 3356

Query: 447  IRPP 458
            + PP
Sbjct: 3357 VAPP 3360



EST assemble image


clone accession position
1 CM053e10_r AV389904 1 240
2 CM017h11_r AV388152 1 595
3 CM010e01_r AV387022 13 481
4 LC084b11_r AV624893 19 518
5 CM073b07_r AV391399 25 274
6 CL07e05_r AV393490 25 532
7 HCL098a03_r AV645080 26 312




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research