KCC000157A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000157A_C01 KCC000157A_c01
gcacttcagtAATTGCAGCTGTATTTACAAATTCTGCTAAGACGACTGCGTAGGGGCGCT
AGTGTAGCGAAGGAGTTCGGTCGTCGGATGCGTTTGTAGCAGCAAAGATGCAGTGCCTAG
ATAAAAGCAGGATGATGCAGGCTAGCTCTCGCTGCGCGTCAGGTTCACGGAGCGTACCTG
CACGCGTCTCCTCACGGGCCAGCGCTGTCAGCGTGCGCTGCACCATCCAGGAGGCCCGCC
CGGCGTCCACACCTGCCGCCGCCAGCACCCCCGCGCTCAATGGCGTCGCGTCCCCTGTCG
CCGGCGCCGTGCCGCCCATCGCGCTGCCACGTGGAGCCGTGCCCAACCGGCCCATCCTGG
AGGTTCCGGACTGGGAGAACCAGTACCGGCGCCACACCGCCTCGGCGCGGCACGGCAGCG
CCGGCACGCCCGGCTCGCTCAGCCGGCTACGCCTGTTCTCGGGGACATCCAATCCGACCC
TGGCCAC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000157A_C01 KCC000157A_c01
         (487 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_767161.1| blr0521 [Bradyrhizobium japonicum] gi|27348769|...    52  5e-06
pir||EDBEIF immediate-early protein IE180 - suid herpesvirus 1 (...    45  6e-04
sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1 precursor (...    44  0.001
gb|AAM08514.1|AC068654_16 Hypothetical protein [Oryza sativa] gi...    44  0.001
gb|AAC82365.1| unknown [Myxococcus xanthus]                            44  0.001

>ref|NP_767161.1| blr0521 [Bradyrhizobium japonicum] gi|27348769|dbj|BAC45786.1|
           blr0521 [Bradyrhizobium japonicum USDA 110]
          Length = 745

 Score = 51.6 bits (122), Expect = 5e-06
 Identities = 33/87 (37%), Positives = 38/87 (42%), Gaps = 3/87 (3%)
 Frame = +1

Query: 193 HGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPSRCHVEPCPTGPSWRFRT 372
           H P     A P+ RPA  P  PPPA     A  P  P   RP+     P P GP+ R   
Sbjct: 132 HAPTPPPPAPPAARPAPTPPAPPPAAAPQHAPPPPPPPAARPTPTPPPPPPAGPAARPTP 191

Query: 373 GRTSTG---ATPPRRGTAAPARPARSA 444
             T+T    A PP   TA P  PA +A
Sbjct: 192 APTATPTPVAPPPAAPTARPGSPAPAA 218

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 33/112 (29%), Positives = 38/112 (33%), Gaps = 11/112 (9%)
 Frame = +1

Query: 184 ASPHGPALSACAAPSRRPARRPHLPPPA-----------PPRSMASRPLSPAPCRPSRCH 330
           A P  PA  A   P+  P   P  PPPA           PP   A+RP  P P  P    
Sbjct: 59  APPAAPARPAAPPPAAAPPHPPAAPPPAAAPPRPAAPPPPPPPPAARPAPPPPPPPPAAP 118

Query: 331 VEPCPTGPSWRFRTGRTSTGATPPRRGTAAPARPARSAGYACSRGHPIRPWP 486
            +P P   +   +   T     PP     AP  PA     A     P  P P
Sbjct: 119 KQPSPPPAAAPQQHAPTPPPPAPP-AARPAPTPPAPPPAAAPQHAPPPPPPP 169

 Score = 40.0 bits (92), Expect = 0.015
 Identities = 34/98 (34%), Positives = 38/98 (38%), Gaps = 1/98 (1%)
 Frame = +1

Query: 190 PHGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPSRCHVEPCPTG-PSWRF 366
           P GPA     AP+  P   P  PPPA P    +RP SPAP         P PT  P+   
Sbjct: 182 PAGPAARPTPAPTATPT--PVAPPPAAP---TARPGSPAPAATPAPTPTPAPTATPAPTA 236

Query: 367 RTGRTSTGATPPRRGTAAPARPARSAGYACSRGHPIRP 480
                ST   PP     AP  P    G   + G P  P
Sbjct: 237 TPAPGSTPGAPPAGRPGAPP-PGVRPGSPPAAGSPPAP 273

 Score = 38.1 bits (87), Expect = 0.056
 Identities = 34/127 (26%), Positives = 44/127 (33%), Gaps = 13/127 (10%)
 Frame = +1

Query: 145 ALAARQVHGAYLHASPHGPALSACAAPSR-----RPARRPHLPPPAPPRSMASRPLSP-- 303
           AL A Q+     HA    P + A A P       +P + P  PP A P +  +RP +P  
Sbjct: 13  ALTAMQLANTASHAQGASPLVVAQAQPQETGPDGKPKQPPKGPPGAAPPAAPARPAAPPP 72

Query: 304 ------APCRPSRCHVEPCPTGPSWRFRTGRTSTGATPPRRGTAAPARPARSAGYACSRG 465
                  P  P      P P  P              PP    AAP +P+     A  + 
Sbjct: 73  AAAPPHPPAAPPPAAAPPRPAAPPPPPPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQQH 132

Query: 466 HPIRPWP 486
            P  P P
Sbjct: 133 APTPPPP 139

 Score = 37.7 bits (86), Expect = 0.074
 Identities = 34/111 (30%), Positives = 38/111 (33%), Gaps = 10/111 (9%)
 Frame = +1

Query: 184 ASPHGPALSACAA----------PSRRPARRPHLPPPAPPRSMASRPLSPAPCRPSRCHV 333
           A PH PA    AA          P   PA RP  PPP PP +   +P  P    P +   
Sbjct: 75  APPHPPAAPPPAAAPPRPAAPPPPPPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQQHAP 134

Query: 334 EPCPTGPSWRFRTGRTSTGATPPRRGTAAPARPARSAGYACSRGHPIRPWP 486
            P P  P    R   T     P      AP  P   A    +R  P  P P
Sbjct: 135 TPPPPAPP-AARPAPTPPAPPPAAAPQHAPPPPPPPA----ARPTPTPPPP 180

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 33/103 (32%), Positives = 38/103 (36%), Gaps = 18/103 (17%)
 Frame = +1

Query: 199 PALSACAAPSRRPARRPHLPPPAPPRSMASRP------------------LSPAPCRPSR 324
           PA  A  AP+  PA      PP+     AS P                  L+P P RP  
Sbjct: 271 PAPGATPAPTTTPAPGGTATPPSGRPGPASTPAPGAATPAPTATPAPGGALTPPPGRPG- 329

Query: 325 CHVEPCPTGPSWRFRTGRTSTGATPPRRGTAAPARPARSAGYA 453
               P P G +         T A PP+ G   PARPA  AG A
Sbjct: 330 AGPTPGPQGGTPPAGAPAAGTPAAPPQAG-GLPARPAAPAGAA 371

 Score = 30.8 bits (68), Expect = 9.0
 Identities = 13/30 (43%), Positives = 18/30 (59%)
 Frame = +3

Query: 240 PASTPAAASTPALNGVASPVAGAVPPIALP 329
           P +TPA  +TPA  G A+P +G   P + P
Sbjct: 273 PGATPAPTTTPAPGGTATPPSGRPGPASTP 302

>pir||EDBEIF immediate-early protein IE180 - suid herpesvirus 1 (strain
           Indiana-Funkhauser)
          Length = 1460

 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 33/101 (32%), Positives = 38/101 (36%), Gaps = 1/101 (0%)
 Frame = +1

Query: 187 SPHGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPSRCHVEPCPTGPSWRF 366
           S  GP       P RRP +      P PP +  +RP  P P RP      P P  P    
Sbjct: 134 SSSGPGPGPAPGPGRRPRQHSQRQRPGPPAAPGARP-PPQPPRPPPPPAPPAPPAPP--- 189

Query: 367 RTGRTSTGATPPRRGTAAPARPARSAGYACSR-GHPIRPWP 486
              R   G  PPR GT +   P R  G    R  H  + WP
Sbjct: 190 -APRRPRGDGPPRGGTRS-VSPGRRRGLGPRRHQHSQQRWP 228

 Score = 32.7 bits (73), Expect = 2.4
 Identities = 38/136 (27%), Positives = 44/136 (31%), Gaps = 40/136 (29%)
 Frame = +1

Query: 196 GPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPS------------------ 321
           GP  +  A P  +P R P  PPPAPP    + P  PAP RP                   
Sbjct: 160 GPPAAPGARPPPQPPRPP--PPPAPP----APPAPPAPRRPRGDGPPRGGTRSVSPGRRR 213

Query: 322 ----RCHVE-------------PCPTGPSWRFRTGRTSTGATPPRRGTA-----APARPA 435
               R H               P P  P    R+ R +  A PP  GTA     + A P 
Sbjct: 214 GLGPRRHQHSQQRWPQRRHGGGPLPQPPPPPGRSRRPAAAAPPPAEGTAVVTITSTASPW 273

Query: 436 RSAGYACSRGHPIRPW 483
                A  R  P   W
Sbjct: 274 LDEPAAARRLDPAAAW 289

>sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1 precursor (Hydroxyproline-rich
           glycoprotein 1) gi|12018147|gb|AAG45420.1|AF309494_1
           vegetative cell wall protein gp1 [Chlamydomonas
           reinhardtii]
          Length = 555

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 29/100 (29%), Positives = 40/100 (40%)
 Frame = +1

Query: 187 SPHGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPSRCHVEPCPTGPSWRF 366
           +P  PA  + A PS  P   P   PP+PP      P  P+P  PS     P P  P+   
Sbjct: 54  APPSPAPPSPAPPSPGP---PSPAPPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPS 110

Query: 367 RTGRTSTGATPPRRGTAAPARPARSAGYACSRGHPIRPWP 486
               +    +PP     +P+ PA  +    S   P+ P P
Sbjct: 111 PAPPSPAPPSPPSPAPPSPSPPAPPSPSPPSPAPPLPPSP 150

 Score = 41.2 bits (95), Expect = 0.007
 Identities = 31/104 (29%), Positives = 41/104 (38%), Gaps = 1/104 (0%)
 Frame = +1

Query: 178 LHASPHGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPSRC-HVEPCPTGP 354
           L  SP  P+ S    PS  P   P   PP+P     S P+ P+P  PS    V P P  P
Sbjct: 146 LPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPP 205

Query: 355 SWRFRTGRTSTGATPPRRGTAAPARPARSAGYACSRGHPIRPWP 486
           S       +    +PP     +P  PA  +    +   P+ P P
Sbjct: 206 SPAPPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPSP 249

 Score = 40.0 bits (92), Expect = 0.015
 Identities = 31/100 (31%), Positives = 38/100 (38%)
 Frame = +1

Query: 187 SPHGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPSRCHVEPCPTGPSWRF 366
           SP  P+ S  A PS  P   P   PP PP      P  P P  PS     P P  P+   
Sbjct: 123 SPAPPSPSPPAPPSPSP---PSPAPPLPPSPAPPSPSPPVPPSPS----PPVPPSPAPPS 175

Query: 367 RTGRTSTGATPPRRGTAAPARPARSAGYACSRGHPIRPWP 486
            T  + +   PP     +PA P   +    S   P+ P P
Sbjct: 176 PTPPSPSPPVPPSPAPPSPAPPVPPSPAPPSPAPPVPPSP 215

 Score = 39.7 bits (91), Expect = 0.019
 Identities = 29/86 (33%), Positives = 33/86 (37%), Gaps = 4/86 (4%)
 Frame = +1

Query: 187 SPHGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPS----RCHVEPCPTGP 354
           SP  P   + A PS  P   P   PP+PP      P SPAP  PS       V P P  P
Sbjct: 193 SPAPPVPPSPAPPSPAPPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPP 252

Query: 355 SWRFRTGRTSTGATPPRRGTAAPARP 432
           S    + +      PP      P RP
Sbjct: 253 SPAPPSPKPPAPPPPPSPPPPPPPRP 278

 Score = 39.3 bits (90), Expect = 0.025
 Identities = 30/100 (30%), Positives = 39/100 (39%)
 Frame = +1

Query: 187 SPHGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPSRCHVEPCPTGPSWRF 366
           SP  P+ +  + PS  P   P  P PAPP      P  P+P  PS     P P  PS   
Sbjct: 67  SPGPPSPAPPSPPSPAPPS-PAPPSPAPPSPAPPSPAPPSPAPPS--PAPPSPAPPSPPS 123

Query: 367 RTGRTSTGATPPRRGTAAPARPARSAGYACSRGHPIRPWP 486
               + +   PP     +PA P   +    S   P+ P P
Sbjct: 124 PAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSP 163

 Score = 38.9 bits (89), Expect = 0.033
 Identities = 34/100 (34%), Positives = 39/100 (39%)
 Frame = +1

Query: 187 SPHGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPSRCHVEPCPTGPSWRF 366
           +P  PA  + A PS  P   P  P PAPP      P SPAP  PS     P P  PS   
Sbjct: 87  APPSPAPPSPAPPSPAPP-SPAPPSPAPPSPAPPSPPSPAPPSPS----PPAPPSPS--- 138

Query: 367 RTGRTSTGATPPRRGTAAPARPARSAGYACSRGHPIRPWP 486
                     PP     +PA P+ S     S   P+ P P
Sbjct: 139 -----PPSPAPPL--PPSPAPPSPSPPVPPSPSPPVPPSP 171

 Score = 37.7 bits (86), Expect = 0.074
 Identities = 30/100 (30%), Positives = 38/100 (38%)
 Frame = +1

Query: 187 SPHGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPSRCHVEPCPTGPSWRF 366
           +P  PA  + A PS  P   P  P PAPP   +  P  P+P  PS     P P  P+   
Sbjct: 49  APPSPAPPSPAPPSPAPPS-PGPPSPAPPSPPSPAP--PSPAPPSPAPPSPAPPSPA--- 102

Query: 367 RTGRTSTGATPPRRGTAAPARPARSAGYACSRGHPIRPWP 486
                     PP     +PA P+  +    S   P  P P
Sbjct: 103 -----PPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSP 137

 Score = 37.0 bits (84), Expect = 0.13
 Identities = 30/100 (30%), Positives = 34/100 (34%)
 Frame = +1

Query: 187 SPHGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPSRCHVEPCPTGPSWRF 366
           SP  P   + A PS  P   P   PP PP      P  P+P  P    V P P  PS   
Sbjct: 141 SPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPP----VPPSPAPPS--- 193

Query: 367 RTGRTSTGATPPRRGTAAPARPARSAGYACSRGHPIRPWP 486
                     PP     +PA P   +    S   P  P P
Sbjct: 194 -----PAPPVPPSPAPPSPAPPVPPSPAPPSPPSPAPPSP 228

 Score = 35.0 bits (79), Expect = 0.48
 Identities = 22/60 (36%), Positives = 27/60 (44%), Gaps = 5/60 (8%)
 Frame = +1

Query: 190 PHGPALSACAAPSRRPARRP---HLPPPAPPRSM--ASRPLSPAPCRPSRCHVEPCPTGP 354
           P  PA  + A PS +P   P     PPP PPR    A+ P+ P+P  P      P P  P
Sbjct: 246 PPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTP 305

 Score = 34.7 bits (78), Expect = 0.62
 Identities = 19/63 (30%), Positives = 22/63 (34%)
 Frame = +1

Query: 247 PHLPPPAPPRSMASRPLSPAPCRPSRCHVEPCPTGPSWRFRTGRTSTGATPPRRGTAAPA 426
           P  P PAPP      P  P+P  PS     P P  P              PP     +PA
Sbjct: 43  PAPPSPAPPSPAPPSPAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPSPA 102

Query: 427 RPA 435
            P+
Sbjct: 103 PPS 105

 Score = 34.7 bits (78), Expect = 0.62
 Identities = 32/102 (31%), Positives = 41/102 (39%), Gaps = 2/102 (1%)
 Frame = +1

Query: 187 SPHGPALSACAAPSRRPARRPH-LPP-PAPPRSMASRPLSPAPCRPSRCHVEPCPTGPSW 360
           SP  P+  + A PS  P   P  +PP PAPP      P  PAP  P      P P  P +
Sbjct: 222 SPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAP-PPPPSPPPPPPPRPPF 280

Query: 361 RFRTGRTSTGATPPRRGTAAPARPARSAGYACSRGHPIRPWP 486
              T    +  +PP     +PA P      + S   P+ P P
Sbjct: 281 PANTPMPPSPPSPP----PSPAPPTPPTPPSPSPPSPVPPSP 318

 Score = 34.3 bits (77), Expect = 0.82
 Identities = 18/60 (30%), Positives = 22/60 (36%)
 Frame = +1

Query: 256 PPPAPPRSMASRPLSPAPCRPSRCHVEPCPTGPSWRFRTGRTSTGATPPRRGTAAPARPA 435
           P PAPP      P  P+P  PS     P P  P+             PP     +PA P+
Sbjct: 41  PSPAPPSPAPPSPAPPSPAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPS 100

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 20/56 (35%), Positives = 23/56 (40%)
 Frame = +1

Query: 190 PHGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPSRCHVEPCPTGPS 357
           P  P  +    P   P+  P   PP PP   +  P SP P  PS   V P P  PS
Sbjct: 276 PRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSPPSPVP--PSPAPVPPSPAPPS 329

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 18/57 (31%), Positives = 24/57 (41%)
 Frame = +1

Query: 184 ASPHGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPSRCHVEPCPTGP 354
           A P  P+ +  + PS  P   P   PP+P       P+ P+P  PS     P P  P
Sbjct: 208 APPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAP 264

 Score = 33.5 bits (75), Expect = 1.4
 Identities = 28/93 (30%), Positives = 32/93 (34%), Gaps = 10/93 (10%)
 Frame = +1

Query: 187 SPHGPALSACAAPSRRPARRPHLP-----PPAPPRSMAS-----RPLSPAPCRPSRCHVE 336
           SP  PA     +P   P  RP  P     PP+PP    S      P  P+P  PS     
Sbjct: 258 SPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSPPSPVPPS 317

Query: 337 PCPTGPSWRFRTGRTSTGATPPRRGTAAPARPA 435
           P P  PS             PP    + P  PA
Sbjct: 318 PAPVPPS-----------PAPPSPAPSPPPSPA 339

 Score = 32.3 bits (72), Expect = 3.1
 Identities = 20/47 (42%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = +1

Query: 184 ASPHGPALSACAAPSRRPARRPHLPP-PAPPRSMASRPLSPAPCRPS 321
           A P  P   + + PS  P     +PP PAPP    S P SPAP  PS
Sbjct: 298 APPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPS 344

>gb|AAM08514.1|AC068654_16 Hypothetical protein [Oryza sativa] gi|31429824|gb|AAP51819.1|
           hypothetical protein [Oryza sativa (japonica
           cultivar-group)]
          Length = 773

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 32/99 (32%), Positives = 38/99 (38%), Gaps = 6/99 (6%)
 Frame = +1

Query: 184 ASPHGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPSRCHVEPCPTGPSWR 363
           A P  PA S  A P   PA  P  PPP PP    S P  P P  P      PCP  P   
Sbjct: 418 APPSPPAPSPPAPPPPPPAPSPPAPPPPPPPPAPSPPAPPPPPPPP----PPCPPAPP-- 471

Query: 364 FRTGRTSTGATPPRRGTAAPARPA------RSAGYACSR 462
               +T +   PP   T A  +        +   Y+CS+
Sbjct: 472 ----KTRSRQAPPPASTRATKKDKVDTTKNKEPPYSCSQ 506

>gb|AAC82365.1| unknown [Myxococcus xanthus]
          Length = 542

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 36/105 (34%), Positives = 42/105 (39%), Gaps = 8/105 (7%)
 Frame = +1

Query: 187 SPHGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAP--------CRPSRCHVEPC 342
           +P GP+   C  P +    R   P PAPPR  A RP +PAP          PS C    C
Sbjct: 99  NPAGPS-RRCGPPRKSTPTRCCTPCPAPPRCRA-RPSAPAPSAGRTCPTAGPSSCASGCC 156

Query: 343 PTGPSWRFRTGRTSTGATPPRRGTAAPARPARSAGYACSRGHPIR 477
           PTG       G T  GA P     +    PA S G   +   P R
Sbjct: 157 PTGRCGS-APGPTPHGAEPSPPSQSPSPAPASSGGRRRTHPRPAR 200

 Score = 37.0 bits (84), Expect = 0.13
 Identities = 34/93 (36%), Positives = 36/93 (38%), Gaps = 18/93 (19%)
 Frame = +1

Query: 247 PHLPPPAPP-----RSMASRPLSPAPCRPS--RC-----HVEPCPTGPSWRFRTGRTSTG 390
           P  PP +PP     R    R   P   R S  RC     H    P GPS R    R ST 
Sbjct: 56  PRAPPRSPPPRRRHRGSRHRSFRPTCARRSGRRCPAPSRHARRNPAGPSRRCGPPRKSTP 115

Query: 391 A---TP---PRRGTAAPARPARSAGYACSRGHP 471
               TP   P R  A P+ PA SAG  C    P
Sbjct: 116 TRCCTPCPAPPRCRARPSAPAPSAGRTCPTAGP 148

 Score = 36.6 bits (83), Expect = 0.16
 Identities = 35/102 (34%), Positives = 46/102 (44%), Gaps = 3/102 (2%)
 Frame = +1

Query: 184 ASPHGPALSACAAPSRRPARRPHLPPPAPPRSMASRPLSPAPCRPSRCHVEPCPTGPSWR 363
           A P  P+ S   AP+    RR   P PA  R+ A+   +PA   P RC   P  TG +  
Sbjct: 172 AEPSPPSQSPSPAPASSGGRRRTHPRPA--RASAAGATAPACLPPPRCCGRP-GTGCA-- 226

Query: 364 FRTGRTSTGAT---PPRRGTAAPARPARSAGYACSRGHPIRP 480
            RT   ST A+   PPR    +P  P R++G   +   P  P
Sbjct: 227 -RTAPPSTSASHPPPPR----SPGTPPRASGSPAAAPAPPSP 263

 Score = 34.3 bits (77), Expect = 0.82
 Identities = 34/113 (30%), Positives = 38/113 (33%), Gaps = 18/113 (15%)
 Frame = +1

Query: 157 RQVHGAYLHASPHGPALSACAAPSR---RPAR-----------RPHLPPP----APPRSM 282
           R+ H     AS  G    AC  P R   RP               H PPP     PPR+ 
Sbjct: 192 RRTHPRPARASAAGATAPACLPPPRCCGRPGTGCARTAPPSTSASHPPPPRSPGTPPRAS 251

Query: 283 ASRPLSPAPCRPSRCHVEPCPTGPSWRFRTGRTSTGATPPRRGTAAPARPARS 441
            S   +PAP  P+ C   P                G TP  R  A PA P  S
Sbjct: 252 GSPAAAPAPPSPA-CRPPP---------------PGTTPAPRNAALPALPCIS 288



EST assemble image


clone accession position
1 LCL015c11_r AV626780 1 398
2 CL07e01_r AV393487 11 487
3 MXL065c02_r BP096809 37 481




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research