KCC000156A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000156A_C01 KCC000156A_c01
gcggccctgaggttcccacgagtggcgcacccgcgctgatgtataaagcggcgcggagac
acccgctcactcgcgggcagGTCTTGGCACGGGGGCGCATCAGGCGCCCCATCCCGGTGT
ACAGGCGCACAATGGATATGTGTCGACGGATACCGGCCGTCCACTCCGCGTGTGTAATGA
GTACGCATGTTACGTGACGAGGACGGGTTTCCAGGACTTGCGGGGTGTTTTTAAGCGTGG
CACATGCCGCCACCCCGCCGGCGTGGGTTTTCCCGCACGCCTTCGCTTGCTACATTAGGT
TGTGGCGCACCAGTACTGCTTTCGTTTGCTGCATGAGTGGCTTGAGAGAGGCGGCTGGAG
GAGCAGAGTGAGGGACGCTGAGGGAGCCTCGCGGCCCATGACTGAAGAGTCTAATGCATC
GTAGTCGCATGTTTCTTTTGCGGTGACGCGTGTTACTTGAGTGACCCTGTGACTGTGAGC
TGTTTGAGCGTGCGCGCCCAAACGCGTGCGAGGAAGCACTGCCTGGCCGCCCGGCCGGCA
GTGACCGTTCGTGTTCATGACCAGTTGGCTAAGCTAAGTATTCTTTGGGGCTTGACTCTC
TGGGGATTCTGGAGGGAGGCGCCATGTCATGGCGTGGGTCCTGCGACGTGTGCCTGTAAG
TAcctgatgtatggaaaaaaaaaaaaaaaaaaactcgagactagt


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000156A_C01 KCC000156A_c01
         (705 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_128495.3| RIKEN cDNA 5033413A03 [Mus musculus]                  40  0.046
dbj|BAC65530.1| mKIAA0324 protein [Mus musculus]                       40  0.046
ref|NP_523779.1| lethal with a checkpoint kinase CG4943-PA [Dros...    39  0.060
ref|NP_780438.1| RIKEN cDNA 5033413A03 [Mus musculus] gi|2635495...    39  0.078
ref|XP_220207.2| similar to splicing coactivator subunit SRm300;...    37  0.23

>ref|XP_128495.3| RIKEN cDNA 5033413A03 [Mus musculus]
          Length = 2607

 Score = 39.7 bits (91), Expect = 0.046
 Identities = 30/107 (28%), Positives = 46/107 (42%)
 Frame = -2

Query: 371  SLCSSSRLSQATHAANESSTGAPQPNVASEGVRENPRRRGGGMCHA*KHPASPGNPSSSR 192
            S  SSS  S ++ +++ SS+ +  P+ A  G +  P+            PASP  P    
Sbjct: 2483 SSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGPQALPK------------PASPKKPPPGE 2530

Query: 191  NMRTHYTRGVDGRYPSTHIHCAPVHRDGAPDAPPCQDLPASERVSPR 51
                   + +D    S  +  +PV R      P  +DL +SERVS R
Sbjct: 2531 RRSRSPRKPIDSLRDSRSLSYSPVERRQPSPQPSPRDLQSSERVSWR 2577

>dbj|BAC65530.1| mKIAA0324 protein [Mus musculus]
          Length = 1754

 Score = 39.7 bits (91), Expect = 0.046
 Identities = 30/107 (28%), Positives = 46/107 (42%)
 Frame = -2

Query: 371  SLCSSSRLSQATHAANESSTGAPQPNVASEGVRENPRRRGGGMCHA*KHPASPGNPSSSR 192
            S  SSS  S ++ +++ SS+ +  P+ A  G +  P+            PASP  P    
Sbjct: 1630 SSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGPQALPK------------PASPKKPPPGE 1677

Query: 191  NMRTHYTRGVDGRYPSTHIHCAPVHRDGAPDAPPCQDLPASERVSPR 51
                   + +D    S  +  +PV R      P  +DL +SERVS R
Sbjct: 1678 RRSRSPRKPIDSLRDSRSLSYSPVERRQPSPQPSPRDLQSSERVSWR 1724

>ref|NP_523779.1| lethal with a checkpoint kinase CG4943-PA [Drosophila melanogaster]
           gi|6646933|gb|AAF21125.1|AF216521_1 E3 ubiquitin ligase
           [Drosophila melanogaster]
           gi|15825411|gb|AAL09691.1|AF416571_1 ubiquitin-protein
           ligase [Drosophila melanogaster]
           gi|20068997|gb|AAM09646.1|AF464851_1 Smad-ubiquitin E3
           ligase Smurf1 [Drosophila melanogaster]
           gi|21627060|gb|AAF57824.3| CG4943-PA [Drosophila
           melanogaster]
          Length = 1061

 Score = 39.3 bits (90), Expect = 0.060
 Identities = 26/77 (33%), Positives = 36/77 (45%), Gaps = 7/77 (9%)
 Frame = -3

Query: 649 TSQDPRHDMAPPSRIPRESSPKEYLA*PTGHEHE---RSLPAGRPGSASSHAFG----RA 491
           T+  PRH  +PP+  P  S P        G+ H     S PAG  G + S+       R+
Sbjct: 400 TTSPPRHSQSPPT--PNISPPASVTPSANGNVHSPNANSTPAGSGGGSRSYTAATPGQRS 457

Query: 490 RSNSSQSQGHSSNTRHR 440
           +  SS+ QG  S+TR R
Sbjct: 458 QRRSSRQQGEESSTRRR 474

>ref|NP_780438.1| RIKEN cDNA 5033413A03 [Mus musculus] gi|26354955|dbj|BAC41104.1|
            unnamed protein product [Mus musculus]
          Length = 2607

 Score = 38.9 bits (89), Expect = 0.078
 Identities = 30/107 (28%), Positives = 46/107 (42%)
 Frame = -2

Query: 371  SLCSSSRLSQATHAANESSTGAPQPNVASEGVRENPRRRGGGMCHA*KHPASPGNPSSSR 192
            S  SSS  S ++ +++ SS+ +  P+ A  G +  P+            PASP  P    
Sbjct: 2483 SSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGPQALPK------------PASPKKPPPGE 2530

Query: 191  NMRTHYTRGVDGRYPSTHIHCAPVHRDGAPDAPPCQDLPASERVSPR 51
                   + +D    S  +  +PV R      P  +DL +SERVS R
Sbjct: 2531 RGSRSPRKPIDSLRDSRSLSYSPVERRQPSPQPSPRDLQSSERVSWR 2577

>ref|XP_220207.2| similar to splicing coactivator subunit SRm300; RNA binding protein;
            AT-rich element binding factor [Rattus norvegicus]
          Length = 1971

 Score = 37.4 bits (85), Expect = 0.23
 Identities = 29/107 (27%), Positives = 45/107 (41%)
 Frame = -2

Query: 371  SLCSSSRLSQATHAANESSTGAPQPNVASEGVRENPRRRGGGMCHA*KHPASPGNPSSSR 192
            S  SSS  S ++ +++ SS+ +  P+ A  G +  P+            PASP  P    
Sbjct: 1837 SSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGPQALPK------------PASPKKPPPGE 1884

Query: 191  NMRTHYTRGVDGRYPSTHIHCAPVHRDGAPDAPPCQDLPASERVSPR 51
                   + +D    S  +  +PV R      P  +D  +SERVS R
Sbjct: 1885 RRSRSPRKPIDSLRDSRSLSYSPVERRQPSPQPSPRDQQSSERVSWR 1931



EST assemble image


clone accession position
1 MXL078b07_r BP097589 1 331
2 CL07c09_r AV393492 147 662
3 MXL057d07_r BP096358 291 674
4 LC010f10_r AV619607 332 705




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research