KCC000155A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000155A_C01 KCC000155A_c01
CCGAAATGCTAATGGGGACCCGCGGCTAAGTCTGCTACGGCAAGGAAGGGTCCATCCATC
GTCGCACATAAGGCCGCTCCGCAGCACCGCGCCCCAGCGTCCTCACTCGGCTTGGACCCC
AGTACTCGATCTCCGAGTAGCACAGGTGGCAATGAGTGCCAGTGTGGCCAACCCGGCCCA
GCAACCCTCTGTCTCTGGCAACGATTTGCAGCAGGGCATGAAGGAGCTGAACATCAAGGA
TAAGGACGATGAGGCGGGGTCAAGCAAGGCGCAGCAGAACGCGGCAACAGCGGAGATTTT
TGAGGGCCGGCTGATTGAGGGCGACCTCAAGACCGGTGGCCATGTGCTGTCGGCGTCGTC
AGGCACTGGGGCTTCTCGGCAGACGTACAACTACTCAACGGACCGGGTCGTAGGCAACGG
GTCCTTTGGTGTGGTCTTCCAAGCGACCTGCCTGGAGACGGGCGAGACGGTTGCCATCAA
GAAGGTGCTGCAGGACAAGCGGTTCAAAAACCGTGAACTGCAAATCATGAAGCTGGTAGA
CATCCCA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000155A_C01 KCC000155A_c01
         (547 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_196968.2| serine/threonine protein kinase, Msk family [Ar...   107  1e-22
pir||T48637 protein kinase MSK-3-like - Arabidopsis thaliana gi|...   107  1e-22
gb|AAQ23109.1| shaggy-related protein kinase 4 [Physcomitrella p...   106  2e-22
gb|AAQ23107.1| shaggy-related protein kinase 2 [Physcomitrella p...   105  3e-22
gb|AAQ23108.1| shaggy-related protein kinase 3 [Physcomitrella p...   105  4e-22

>ref|NP_196968.2| serine/threonine protein kinase, Msk family [Arabidopsis thaliana]
           gi|18086450|gb|AAL57679.1| AT5g14640/T15N1_130
           [Arabidopsis thaliana] gi|34365555|gb|AAQ65089.1|
           At5g14640/T15N1_130 [Arabidopsis thaliana]
          Length = 410

 Score =  107 bits (267), Expect = 1e-22
 Identities = 57/133 (42%), Positives = 80/133 (59%), Gaps = 2/133 (1%)
 Frame = +2

Query: 155 SASVANPAQQPSVSGNDLQQGMKELNIKDKDDEAGSSKAQQNAATAEIFEGRLIEGDLKT 334
           ++S+A      S+    L +G+ E+ IKD  +                 E  +++G+   
Sbjct: 9   ASSMATKQSNASICAEKLPEGINEMKIKDDKE----------------MEAAVVDGNGTE 52

Query: 335 GGHVLSASSG--TGASRQTYNYSTDRVVGNGSFGVVFQATCLETGETVAIKKVLQDKRFK 508
            GH++  + G   G  +QT +Y  +R+VG GSFG+VFQA CLETGETVAIKKVLQDKR+K
Sbjct: 53  TGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYK 112

Query: 509 NRELQIMKLVDIP 547
           NRELQ M+L+D P
Sbjct: 113 NRELQTMRLLDHP 125

>pir||T48637 protein kinase MSK-3-like - Arabidopsis thaliana
           gi|7573313|emb|CAB87631.1| protein kinase MSK-3-like
           [Arabidopsis thaliana]
          Length = 408

 Score =  107 bits (267), Expect = 1e-22
 Identities = 57/133 (42%), Positives = 80/133 (59%), Gaps = 2/133 (1%)
 Frame = +2

Query: 155 SASVANPAQQPSVSGNDLQQGMKELNIKDKDDEAGSSKAQQNAATAEIFEGRLIEGDLKT 334
           ++S+A      S+    L +G+ E+ IKD  +                 E  +++G+   
Sbjct: 9   ASSMATKQSNASICAEKLPEGINEMKIKDDKE----------------MEAAVVDGNGTE 52

Query: 335 GGHVLSASSG--TGASRQTYNYSTDRVVGNGSFGVVFQATCLETGETVAIKKVLQDKRFK 508
            GH++  + G   G  +QT +Y  +R+VG GSFG+VFQA CLETGETVAIKKVLQDKR+K
Sbjct: 53  TGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYK 112

Query: 509 NRELQIMKLVDIP 547
           NRELQ M+L+D P
Sbjct: 113 NRELQTMRLLDHP 125

>gb|AAQ23109.1| shaggy-related protein kinase 4 [Physcomitrella patens]
          Length = 424

 Score =  106 bits (265), Expect = 2e-22
 Identities = 58/129 (44%), Positives = 81/129 (61%), Gaps = 2/129 (1%)
 Frame = +2

Query: 167 ANPAQQPSVSGNDLQQGMKELNIKDKDDEAGSSKAQQNAATAEIFEGRLIEGDLKTGGHV 346
           A P +  S     L + M E+ ++D   + G  K           E  +++G+    GH+
Sbjct: 20  AAPTKAGSSGVELLPKEMHEMKLRDDKVDHGDDKE---------IEATVVDGNGTETGHI 70

Query: 347 LSASSG--TGASRQTYNYSTDRVVGNGSFGVVFQATCLETGETVAIKKVLQDKRFKNREL 520
           ++ + G   G  +QT +YS +RVVG GSFG+VFQA C+E+GETVAIKKVLQDKR+KNREL
Sbjct: 71  IATTIGGRNGQPKQTISYSAERVVGTGSFGIVFQAKCIESGETVAIKKVLQDKRYKNREL 130

Query: 521 QIMKLVDIP 547
           QIM+L+D P
Sbjct: 131 QIMRLLDHP 139

>gb|AAQ23107.1| shaggy-related protein kinase 2 [Physcomitrella patens]
           gi|33591216|gb|AAQ23112.1| shaggy-related protein kinase
           2 [Physcomitrella patens]
          Length = 423

 Score =  105 bits (263), Expect = 3e-22
 Identities = 61/140 (43%), Positives = 91/140 (64%), Gaps = 4/140 (2%)
 Frame = +2

Query: 140 AQVAMSASVANPAQQPSVSGNDLQQGM-KELN-IKDKDDEAGSSKAQQNAATAEIFEGRL 313
           A +A S ++      P  +G+   + + KE++ +K +DD+   S  ++        E  +
Sbjct: 6   AGLAGSTNMIGGGTAPIKAGSSGVESLPKEMHDMKLRDDKVDHSDDKE-------IEASV 58

Query: 314 IEGDLKTGGHVLSASSG--TGASRQTYNYSTDRVVGNGSFGVVFQATCLETGETVAIKKV 487
           ++G+    GH+++ + G   G  +QT +YS +RVVG GSFG+VFQA C+ETGETVAIKKV
Sbjct: 59  VDGNGTETGHIIATTIGGKNGQPKQTISYSAERVVGTGSFGIVFQAKCIETGETVAIKKV 118

Query: 488 LQDKRFKNRELQIMKLVDIP 547
           LQDKR+KNRELQIM+L+D P
Sbjct: 119 LQDKRYKNRELQIMRLLDHP 138

>gb|AAQ23108.1| shaggy-related protein kinase 3 [Physcomitrella patens]
           gi|33591218|gb|AAQ23113.1| shaggy-related protein kinase
           3 [Physcomitrella patens]
          Length = 423

 Score =  105 bits (262), Expect = 4e-22
 Identities = 54/108 (50%), Positives = 76/108 (70%), Gaps = 2/108 (1%)
 Frame = +2

Query: 230 NIKDKDDEAGSSKAQQNAATAEIFEGRLIEGDLKTGGHVLSASSG--TGASRQTYNYSTD 403
           ++K +DD+   S  ++        E  +++G+    GH+++ + G   G  +QT +YS +
Sbjct: 38  DMKLRDDKVDHSDDKE-------IEASIVDGNGTETGHIIATTIGGRNGQPKQTISYSAE 90

Query: 404 RVVGNGSFGVVFQATCLETGETVAIKKVLQDKRFKNRELQIMKLVDIP 547
           RVVG GSFG+VFQA C+ETGETVAIKKVLQDKR+KNRELQIM+L+D P
Sbjct: 91  RVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHP 138



EST assemble image


clone accession position
1 MXL013f01_r BP093774 1 295
2 CL77h05_r AV397286 50 590
3 CL07c08_r AV393452 77 712
4 LC079c08_r AV624550 89 559
5 LC022g01_r AV620480 89 632
6 LC007f02_r AV619381 89 538
7 LCL074d03_r AV630151 101 553
8 LC060a07_r AV623179 102 520
9 CM093c05_r AV392961 105 303
10 LCL027c02_r AV627469 110 586
11 CM014g06_r AV387393 111 728
12 LC045g09_r AV622298 173 646
13 CM084d11_r AV392610 243 445
14 CM047h04_r AV388598 447 675




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research