KCC000154A_c05
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000154A_C05 KCC000154A_c05
CTGGCACTAGACCAGACAGGCAGAACTTTCTTAACAACTTTCAAGGCCCTTAGCTGGCCA
ACCCGTTGCCTACTTCTGCAAAGCAGAGTAGCGCGGTTCTACCGACCCTCGCTTCGGTCC
AAAGGTTTTGAGAAGGATGTCTGCCGACGCCGACGTTAACCTGGTGATTCGGATTGAGGA
GGTCAGCTCGAAGATTGCTGAGCTGCCGGAGTCGAAGGCTTCCGCTGAGATCATCGCTAA
GGTCGCCAGCGGCGATGCCTCGGCGGCCTGATGCCCTCGCGGCCCACCTGAAGAAGGCTG
GTGCCAACGGGCTTCGGTGCCACCGCTGCCCTGAAGGCGGCCATCGAGGACAAGGCCAAC
CCCGGCTGCCCGTCAGGCTGGTCTTGCTGCTTACCAGGCCATCTGCGACAACATCGGCAG
CGCTGCTGAGCCCTTCCTGGCCCCCCTGCTGCCCGCCGTGCTGGAGCAGTGCGGTGACAA
GAAGCCCGAGGTGAAGGCCGCCGCTGAGTGCCGCCTCCAAGGCGCTGATCAGCATCATCA
ACCCCCACGCCGTGTACACCATCCTGGGCTACCTGTTCGAGTGCATGGACGCCAAGAAGC
ACCCCGCCACCAAGGAGGCCTCGCTGCTGCTGGTGAAGCAGCTGGTGGGCATGCACCCCA
AGCAGATTACCCGCGCCCTGCCCGACATCGTGCCCGCCGTCTCCGGCTGCATGAACGACT
CCAAGCAGAGCGTCAAGGACGTGGCCACCGAGACCATGAAGGAGGCCTGCACGCTGGTGG
TGCAACCGCGACATCAACGCCATGGTGCCCCTGATCATCCGCTCCATCAACCACCCCGAG
GAGGTGCAGGAGACCGTGCACAAGCTGGCCTCCACCACCTTCGTGCAGGCGGTTGAGGCC
CCCGCCCTGGCCATGATGGTGCCCCTGGCTGCTGCGCGGTCTGCGCGAGCGCGTGACCTG
CCATCAAGCGCAATGGCCGCCGTGGTGGCGTGACAACATGGCTAAGCTGGTGGACAACCC
GGCTGAGGCCCTGGTGTTCCTGCCCCGCCTGATGCCTGAGATCGAGAAGGTGGCCAACGA
GGCCGCTGACCCCGAGCTGCGCAAGGTGTCGAACAGCGCCATCAAGACGCTGCAGCACAT
CGAGACCGAGGGCAAGGCCAAGCTGGCCAAGACCCTGGACAAGGTGCTGCCGCCCTGAAG
ACCCTGCACGACCTGCTGGCGGCCACCGCCGAGGGCAAGAAGGGCCTGGTCCCCGAGGCC
TACCCCGTGCTGGACTACGCCGCCGCCCTGTGCTGCCAACCTGACCAACAACAAGAACTT
CGAGATTGAGGAGTGGCGCGACAAGGTGATCGGCACCTACCTGGGCGTGTTCGTGTCCAA
GGACACCCTGGCCCCCATCGCTCAGACCCTGGCCGACAAGTGCTTCGCCGAGGTGCAGGT
CAAGTCCACCGAGTACTTCGACGACGAGGAGGGCGAGGAGCTGTGCAACTGCGAGTTCTC
GCTGGCGTACGGTGCCAAGATTCTGCTCAACAACGCCGCGCTGCGCCTGAAGCGTGGCCG
CCGCTACGGCCTGTGCGGCCCCAACGGCGTGGGCAAGTCCACGCTGATGCGCGCCATTGC
CAACGGCCAGGTGGACGGCTTCCCGCCCAAGGACGTGCTGCGCACCGTGTACGTGGAGCA
CGACATCGACGGCTCGCTGTCGGACCTGAACTGCGTGGAGTTCGTCTTCGCCGACGAGAA
CCTGCAGGCCGCCGTGAACACCACCAAGGAGCAGGTGACCAGCATGCTCTCGTCCGTCGG
CTTCACCGAGGAGCTGCTGAACAAGGCCGTGGGCTCGCTGTCCGGCGGCTGGAAGATGAA
GCTGGCGCTGGCCCGCACCATGCTGATGAAGCCCGACATCATGCTCCTGGACGAGCCCAC
CAACCATCTGGACGTGCACAACGTCAAGTGGCTGGAGGACTACCTGGTGGGCCTGGACGA
GGTGTCCTCCATCATTGTGTCGCACGACTCCGGCTTCCTGCGACCACGTGTGCACGCACA
TCATCGACTACAACAACCGCAAGCTGCGCGTGTACAAGGGCAACCTCTCGAAGTTCGTGG
AGCAGAAGCCCGAGGCCAAGGCCTACTACGAGCTGACTGCCTCCACCCTGACCTTCAAGC
TGCCCGAGCCCGGCTACCTGGAGGGTGTCAAGACCAAGGACAAGGCCATCCTGAAGGCCG
ACCGCGTGTCCTACAAGTACCCCAACACCGACCGCATGATCTTCGAGGGCGCCACCGCCT
ACTGCACCCTGTCGTCGCGCGTGGCCTGCATTGGCCCCAACGGCGCCGGCAAGTCGACCC
TGATCAAGGTGCTGACCGGCGAGGTGGAGCCCGTGGCCGGCACCGTGTGGAAGCACCCCA
ACCTGCGCATCGCCTACGTGGCGCAGCACGCCTTCCACCACCTGGAGAAGCACCTGGACA
AGACTCCCAACGAGTACATCCAGTGGCGCTTCGCCCCCGGTGAGGACCGCGAGGCCCAGG
AGAAGGAGACCCGCCTGACCGAGGAGGAGCAGAAGAAGCTGCAGGAGAACAAGGTGCAGA
TCGGCGACGACCCGAAGGTCAAGCGCTCGGTGGAGAAGCTGCTGGCTCGCCGCAAGCTGA
AGAAGTCGTACGAGTACGAGGTGCAGTGGGCCAACACCGCCGCCGACCAGACCAGCTGGC
TGCCCCGCGACACCCTGGTGGAGCTGGGCTACGAGAAGCTGGTGAACGAGCTGGACATCA
AGGAGGCCGCCGCGCTGGGCCTGTTCACCCGCCCGCTCACCACCGCCTCGATCCAGAAGC
ACC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000154A_C05 KCC000154A_c05
         (2823 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_049022.1| Chlorella virus CVK2 translation elongation fac...   303  e-173
pir||A48779 translation elongation factor EF-3 homolog - Chlorel...   272  e-155
ref|NP_015098.1| This gene encodes a protein with an Q/N-rich am...   274  e-148
ref|NP_593609.1| putative translation elongation factor [Schizos...   270  e-144
ref|NP_014384.1| Translational elongation factor EF-3B; Hef3p [S...   279  e-144

>ref|NP_049022.1| Chlorella virus CVK2 translation elongation factor-3 homolog, refer
            to GenBank Accession Number D16505 [Paramecium bursaria
            Chlorella virus 1] gi|7461899|pir||T18168 translation
            elongation factor EF-3 homolog A666L - Chlorella virus
            PBCV-1 gi|2447123|gb|AAC96981.1| Chlorella virus CVK2
            translation elongation factor-3 homolog, refer to GenBank
            Accession Number D16505 [Paramecium bursaria Chlorella
            virus 1]
          Length = 918

 Score =  303 bits (777), Expect(4) = e-173
 Identities = 148/269 (55%), Positives = 201/269 (74%), Gaps = 2/269 (0%)
 Frame = +3

Query: 2022 DHVCTHIIDYN-NRKLRVYKGNLSKFVEQKPEAKAYYELTASTLTFKLPEPGYLEGVKTK 2198
            D VCT II Y  N KL+ YKGNLS+FV+++PE+ +YY LT +  T+K PEPG+LEG+ +K
Sbjct: 495  DAVCTSIIHYEPNLKLKKYKGNLSEFVKKRPESASYYALTETKTTWKFPEPGFLEGITSK 554

Query: 2199 DKAILKADRVSYKYPNTDRMIFEGATAYCTLSSRVACIGPNGAGKSTLIKVLTGEVEPVA 2378
            D+AI+K   V +KYP T+++IF+   A  +L+SR+  +G NGAGKSTLIKVLTG++E   
Sbjct: 555  DRAIMKLRGVGFKYPGTEKLIFDNVNAQVSLNSRIGVVGENGAGKSTLIKVLTGQMEATI 614

Query: 2379 GTVWKHPNLRIAYVAQHAFHHLEKHLDKTPNEYIQWRFAPGEDREAQEKETRL-TEEEQK 2555
            G+VWKHPN+R+AYVAQHAFHH+E HLD TPN+YIQWR+A GED+E  +  +R   EEE K
Sbjct: 615  GSVWKHPNMRLAYVAQHAFHHIEDHLDMTPNQYIQWRYASGEDKETLDVVSRKNNEEELK 674

Query: 2556 KLQENKVQIGDDPKVKRSVEKLLARRKLKKSYEYEVQWANTAADQTSWLPRDTLVELGYE 2735
            K+ + KV  G    VK+ ++K+L RRKLKKSYEYEVQW N   + T W+ R+ L E G+ 
Sbjct: 675  KMYDTKVVDG----VKKILDKILGRRKLKKSYEYEVQWKND--ETTQWMSRERLEEYGFG 728

Query: 2736 KLVNELDIKEAAALGLFTRPLTTASIQKH 2822
            KL+N++D KEA A G+F +PLT  ++++H
Sbjct: 729  KLLNDIDTKEAVANGMF-KPLTAKNVEEH 756

 Score =  272 bits (696), Expect(4) = e-173
 Identities = 158/369 (42%), Positives = 219/369 (58%), Gaps = 3/369 (0%)
 Frame = +2

Query: 923  PWLLRGLRERVTCHQAQWPPWWRDNMAKLVDNPAEALVFLPRLMPEIEKVANEAADPELR 1102
            P L+RGL +R T  + +     R NMAKLVD+P++A  F   L+ +++  A   ++PE R
Sbjct: 163  PLLVRGLADRTTPVRRKTCVIIR-NMAKLVDDPSDAAKFAYLLVDKVKSAAEGMSNPEAR 221

Query: 1103 KVSNSAIKTLQHIETEGKAKLAKT-LDKVLPP*RPCTTCWRPPPRARRAWSPRPTPCWTT 1279
            KV+   +  L  I+T        T +  V+                      + T  +  
Sbjct: 222  KVAEECLDILSTIDTSFVNTTENTDITSVVK---------------------KYTDDYEY 260

Query: 1280 PPPCAANLTNNKNFEIEEWRDKV-IGTYLGVFVSKDTLAPIAQTLADKCFAEVQVKSTEY 1456
                  +L + K F ++ W+  + +  + G++              D CF EV+ K+   
Sbjct: 261  VSGIVEHLIDLKEFNVDIWKSAIDVEDFSGLY--------------DTCFEEVKKKNVTN 306

Query: 1457 FDDEE-GEELCNCEFSLAYGAKILLNNAALRLKRGRRYGLCGPNGVGKSTLMRAIANGQV 1633
             DDEE GE+LC+CEFSLAYG KILLNN    LKRG RYGLCGPNG GKSTLMRAI NGQ+
Sbjct: 307  DDDEEVGEDLCDCEFSLAYGGKILLNNTRFNLKRGNRYGLCGPNGAGKSTLMRAIVNGQL 366

Query: 1634 DGFPPKDVLRTVYVEHDIDGSLSDLNCVEFVFADENLQAAVNTTKEQVTSMLSSVGFTEE 1813
            +GFP  DVL+T YVEHD+DGS S+   ++F+  DE ++  +  ++E++ + L SVGF  E
Sbjct: 367  EGFPSADVLKTAYVEHDLDGSDSNTAIIDFIANDEQVKENI-WSREKIVTTLESVGFDIE 425

Query: 1814 LLNKAVGSLSGGWKMKLALARTMLMKPDIMLLDEPTNHLDVHNVKWLEDYLVGLDEVSSI 1993
              +  + +LSGGWKMKLALAR ML+   ++LLDEPTNHL V NV+WL +YL+ L +VS +
Sbjct: 426  RQSAPINTLSGGWKMKLALARAMLLNAKLLLLDEPTNHLSVSNVRWLIEYLINLKDVSCV 485

Query: 1994 IVSHDSGFL 2020
            IVSHDSGFL
Sbjct: 486  IVSHDSGFL 494

 Score = 53.9 bits (128), Expect(4) = e-173
 Identities = 22/48 (45%), Positives = 36/48 (74%)
 Frame = +1

Query: 784 NRDINAMVPLIIRSINHPEEVQETVHKLASTTFVQAVEAPALAMMVPL 927
           N+DI   +P +++SI  P++V E VH L++TTFVQ+V+A  L+++ PL
Sbjct: 117 NKDIEPFIPHLVKSIGSPQDVPECVHNLSATTFVQSVDAKTLSILTPL 164

 Score = 47.8 bits (112), Expect(4) = e-173
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +3

Query: 531 SIINPHAVYTILGYLFECMDAKKHPA--TKEASLLLVKQLVGMHPKQITRALPDIVPAVS 704
           S IN  A Y++   L +   A K P   TKE +   ++ L   H K +   LP+IVP V+
Sbjct: 33  SFINSMAPYSVKMVLPKVFSAMKDPKWQTKEFACGFLENLALTH-KNVCVYLPEIVPVVT 91

Query: 705 GCMNDSKQSVKDVATETMKEACTL 776
            CM D KQ VKD AT+ +   C +
Sbjct: 92  DCMIDLKQVVKDSATKALIACCQI 115

 Score = 45.4 bits (106), Expect = 0.005
 Identities = 24/88 (27%), Positives = 48/88 (54%), Gaps = 1/88 (1%)
 Frame = +2

Query: 1763 TKEQVTSMLSSVGFTEELLNKA-VGSLSGGWKMKLALARTMLMKPDIMLLDEPTNHLDVH 1939
            T + V   +++VG   E    + +  LSGG K+KL +   +  +P +++LDEPTN +D  
Sbjct: 749  TAKNVEEHMANVGLDPEFTTHSRIRGLSGGQKLKLVIGAALWQQPHVIVLDEPTNFVDRE 808

Query: 1940 NVKWLEDYLVGLDEVSSIIVSHDSGFLR 2023
            ++  + + L        +++SH + F++
Sbjct: 809  SLGAMAEALKNFGG-GVVVISHSNEFVK 835

>pir||A48779 translation elongation factor EF-3 homolog - Chlorella virus CVK2
            gi|454301|dbj|BAA03956.1| translation elongation factor-3
            [Chlorella virus]
          Length = 1120

 Score =  272 bits (695), Expect(4) = e-155
 Identities = 161/370 (43%), Positives = 219/370 (58%), Gaps = 4/370 (1%)
 Frame = +2

Query: 923  PWLLRGLRERVTCHQAQWPPWWRDNMAKLVDNPAEALVFLPRLMPEIEKVANEAADPELR 1102
            P L+RGL +R T  + +     R NMAKLVD+P++A  F   L+ +++  A   ++PE R
Sbjct: 380  PLLVRGLADRTTPVRRKTCVIIR-NMAKLVDDPSDAAKFAYLLVDKVKSAAEGMSNPEAR 438

Query: 1103 KVSNSAIKTLQHIETEGKAKLAKT-LDKVLPP*RPCTTCWRPPPRARRAWSPRPTPCWTT 1279
            KV+   +  L  I+T        T +  V+                      + T  +  
Sbjct: 439  KVAEECLDILSTIDTSFVNTTENTDITSVVK---------------------KYTDDYEY 477

Query: 1280 PPPCAANLTNNKNFEIEEWRDKV-IGTYLGVFVSKDTLAPIAQTLADKCFAEVQVKSTEY 1456
                  +L + K F ++ W+  + +  + G++              D CF EV+ K+   
Sbjct: 478  VSGIVEHLIDLKEFNVDIWKSAIDVEDFSGLY--------------DTCFEEVKKKNVTN 523

Query: 1457 FDDEE-GEELCNCEFSLAYGAKILLNNAALRLKRGRRYGLCGPNGVGKSTLMRAIANGQV 1633
             DDEE GE+LC+CEFSLAYG KILLNN    LKRG RYGLCGPNG GKSTLMRAI NGQ+
Sbjct: 524  DDDEEVGEDLCDCEFSLAYGGKILLNNTRFNLKRGNRYGLCGPNGAGKSTLMRAIVNGQL 583

Query: 1634 DGFPPKDVLRTVYVEHDIDGSLSDLNCVEFVFADENLQAAVNT-TKEQVTSMLSSVGFTE 1810
            +GFP  DVL+T YVEHD+DGS S+   ++F+  DE  Q   NT ++E++ + L SVGF  
Sbjct: 584  EGFPSADVLKTAYVEHDLDGSDSNTAIIDFIANDE--QVKENTWSREKIVTTLESVGFDI 641

Query: 1811 ELLNKAVGSLSGGWKMKLALARTMLMKPDIMLLDEPTNHLDVHNVKWLEDYLVGLDEVSS 1990
            E  +  + +LSGGWKMKLALAR ML+   ++LLDEPTNHL V NV+WL +YL  L++VS 
Sbjct: 642  ERQSAPINTLSGGWKMKLALARAMLLDAKLLLLDEPTNHLSVSNVRWLIEYLTNLEDVSC 701

Query: 1991 IIVSHDSGFL 2020
            +IVSHDSGFL
Sbjct: 702  VIVSHDSGFL 711

 Score =  245 bits (626), Expect(4) = e-155
 Identities = 127/270 (47%), Positives = 183/270 (67%), Gaps = 3/270 (1%)
 Frame = +3

Query: 2022 DHVCTHIIDYN-NRKLRVYKGNLSKFVEQKPEAKAYYELTASTLTFKLPEPGYLEGVKTK 2198
            D VCT II Y  N KL+ YKGNLS+FV+++PE+ +YY LT +  T+K PEPG+LEG+ ++
Sbjct: 712  DAVCTSIIHYEPNLKLKKYKGNLSEFVKKRPESASYYALTETKTTWKFPEPGFLEGITSR 771

Query: 2199 DKAILKADRVSYKYPNTDRMIFEGATAYCTLSSRVACIGPNGAGKSTLIKVLTGEVEPVA 2378
            D+AI+K   V +KYP T+++IF+   A  +L+SR+  +G NGAGKS L  V +G +    
Sbjct: 772  DRAIMKLRGVGFKYPGTEKLIFDNVNAQVSLNSRIGVVGENGAGKSALFLVFSGGMWAPP 831

Query: 2379 GTVWKHPNLRIAYVAQHAFHHLEK-HLDKTPNEYIQWRFAPGEDREAQEKETRL-TEEEQ 2552
            G V+  P++ + +V Q       + HLD TPN+YIQWR+A GED+E  +  +R   EEE 
Sbjct: 832  GVVFGRPHMCVFFVWQRMLSTTSRDHLDMTPNQYIQWRYASGEDKETLDVVSRKNNEEEL 891

Query: 2553 KKLQENKVQIGDDPKVKRSVEKLLARRKLKKSYEYEVQWANTAADQTSWLPRDTLVELGY 2732
            KK+ + KV  G    VK+ ++K+L RRKLKKSYEYEVQW N   + T W+ R+ L E G+
Sbjct: 892  KKMYDTKVVDG----VKKILDKILGRRKLKKSYEYEVQWKND--ETTQWMSRERLEEYGF 945

Query: 2733 EKLVNELDIKEAAALGLFTRPLTTASIQKH 2822
             KL+N++D KEA A G+F +PLT  ++++H
Sbjct: 946  GKLLNDIDTKEAVANGMF-KPLTAKNVEEH 974

 Score = 53.9 bits (128), Expect(4) = e-155
 Identities = 22/48 (45%), Positives = 36/48 (74%)
 Frame = +1

Query: 784 NRDINAMVPLIIRSINHPEEVQETVHKLASTTFVQAVEAPALAMMVPL 927
           N+DI   +P +++SI  P++V E VH L++TTFVQ+V+A  L+++ PL
Sbjct: 334 NKDIEPFIPHLVKSIGSPQDVPECVHNLSATTFVQSVDAKTLSILTPL 381

 Score = 47.4 bits (111), Expect(4) = e-155
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +3

Query: 531 SIINPHAVYTILGYLFECMDAKKHPA--TKEASLLLVKQLVGMHPKQITRALPDIVPAVS 704
           S IN  A Y++   L +   A K P   TKE +   ++ L   H K +   LP+IVP V+
Sbjct: 250 SFINSMAPYSVKMVLPKVFSAMKDPKWQTKEFACGFLENLALTH-KNVCVYLPEIVPVVT 308

Query: 705 GCMNDSKQSVKDVATETMKEACTL 776
            CM D KQ VKD AT+ +   C +
Sbjct: 309 DCMLDLKQVVKDNATKALIACCQI 332

 Score = 45.4 bits (106), Expect = 0.005
 Identities = 24/88 (27%), Positives = 48/88 (54%), Gaps = 1/88 (1%)
 Frame = +2

Query: 1763 TKEQVTSMLSSVGFTEELLNKA-VGSLSGGWKMKLALARTMLMKPDIMLLDEPTNHLDVH 1939
            T + V   +++VG   E    + +  LSGG K+KL +   +  +P +++LDEPTN +D  
Sbjct: 967  TAKNVEEHMANVGLDPEFTTHSRIRGLSGGQKLKLVIGAALWQQPHVIVLDEPTNFVDRE 1026

Query: 1940 NVKWLEDYLVGLDEVSSIIVSHDSGFLR 2023
            ++  + + L        +++SH + F++
Sbjct: 1027 SLGAMAEALKNFGG-GVVVISHSNEFVK 1053

>ref|NP_015098.1| This gene encodes a protein with an Q/N-rich amino terminal domain
            that acts as a prion, termed [NU]+.; New1p [Saccharomyces
            cerevisiae] gi|2132238|pir||S65245 translation elongation
            factor eEF-3 homolog YPL226w - yeast  (Saccharomyces
            cerevisiae) gi|1370468|emb|CAA97941.1| unnamed protein
            product [Saccharomyces cerevisiae]
          Length = 1196

 Score =  274 bits (701), Expect(3) = e-148
 Identities = 135/267 (50%), Positives = 180/267 (66%)
 Frame = +3

Query: 2022 DHVCTHIIDYNNRKLRVYKGNLSKFVEQKPEAKAYYELTASTLTFKLPEPGYLEGVKTKD 2201
            D VCT II Y N+KL  YKGNL+ FVEQKPEAK+YY LT S    + P PG L GVK+  
Sbjct: 749  DTVCTDIIHYENKKLAYYKGNLAAFVEQKPEAKSYYTLTDSNAQMRFPPPGILTGVKSNT 808

Query: 2202 KAILKADRVSYKYPNTDRMIFEGATAYCTLSSRVACIGPNGAGKSTLIKVLTGEVEPVAG 2381
            +A+ K   V++ YP   +      +   +LSSRVAC+GPNGAGKSTLIK+LTGE+ P  G
Sbjct: 809  RAVAKMTDVTFSYPGAQKPSLSHVSCSLSLSSRVACLGPNGAGKSTLIKLLTGELVPNEG 868

Query: 2382 TVWKHPNLRIAYVAQHAFHHLEKHLDKTPNEYIQWRFAPGEDREAQEKETRLTEEEQKKL 2561
             V KHPNLRI Y+AQHA  H+ +H +KT N+Y+QWR+  G+DRE   KE+R   E++K++
Sbjct: 869  KVEKHPNLRIGYIAQHALQHVNEHKEKTANQYLQWRYQFGDDREVLLKESRKISEDEKEM 928

Query: 2562 QENKVQIGDDPKVKRSVEKLLARRKLKKSYEYEVQWANTAADQTSWLPRDTLVELGYEKL 2741
               ++ I DD + KR++E ++ R+KLKKS++YEV+W        SW+P+D LVE G+EKL
Sbjct: 929  MTKEIDI-DDGRGKRAIEAIVGRQKLKKSFQYEVKWKYWKPKYNSWVPKDVLVEHGFEKL 987

Query: 2742 VNELDIKEAAALGLFTRPLTTASIQKH 2822
            V + D  EA+  GL  R L  + I KH
Sbjct: 988  VQKFDDHEASREGLGYRELIPSVITKH 1014

 Score =  256 bits (653), Expect(3) = e-148
 Identities = 152/353 (43%), Positives = 211/353 (59%), Gaps = 10/353 (2%)
 Frame = +2

Query: 992  DNMAKLVDNPAEALVFLPRLMPEIEKVANEAADPELRKVSNSAIKTLQH---IETEGKAK 1162
            +N+ +LV+N  E   F+P L+P I+KV + A+ PE+R+++  A+  L+     + E K  
Sbjct: 412  ENLTRLVNNRNEIESFIPLLLPGIQKVVDTASLPEVRELAEKALNVLKEDDEADKENKFS 471

Query: 1163 LAKTLDKV-------LPP*RPCTTCWRPPPRARRAWSPRPTPCWTTPPPCAANLTNNKNF 1321
               TL++        L   +   +C+  P               T     +  LT + N 
Sbjct: 472  GRLTLEEGRDFLLDHLKDIKADDSCFVKPYMNDE----------TVIKYMSKILTVDSN- 520

Query: 1322 EIEEWRDKVIGTYLGVFVSKDTLAPIAQTLADKCFAEVQVKSTEYFDDEEGEELCNCEFS 1501
             + +W+ ++      VF   D+     +         +  +  E  D++EG E+ N +FS
Sbjct: 521  -VNDWK-RLEDFLTAVFGGSDSQREFVKQDFIHNLRALFYQEKERADEDEGIEIVNTDFS 578

Query: 1502 LAYGAKILLNNAALRLKRGRRYGLCGPNGVGKSTLMRAIANGQVDGFPPKDVLRTVYVEH 1681
            LAYG+++LLN   LRL +G RYGLCG NG GKSTLMRAIANGQ+DGFP KD LRT +VEH
Sbjct: 579  LAYGSRMLLNKTNLRLLKGHRYGLCGRNGAGKSTLMRAIANGQLDGFPDKDTLRTCFVEH 638

Query: 1682 DIDGSLSDLNCVEFVFADENLQAAVNTTKEQVTSMLSSVGFTEELLNKAVGSLSGGWKMK 1861
             + G   DL+ V F+  DE LQ   +T++E++ + L SVGF EE   + VGSLSGGWKMK
Sbjct: 639  KLQGEEGDLDLVSFIALDEELQ---STSREEIAAALESVGFDEERRAQTVGSLSGGWKMK 695

Query: 1862 LALARTMLMKPDIMLLDEPTNHLDVHNVKWLEDYLVGLDEVSSIIVSHDSGFL 2020
            L LAR ML K DI+LLDEPTNHLDV NVKWLE+YL+   +++S+IVSHDSGFL
Sbjct: 696  LELARAMLQKADILLLDEPTNHLDVSNVKWLEEYLLEHTDITSLIVSHDSGFL 748

 Score = 47.4 bits (111), Expect = 0.001
 Identities = 29/87 (33%), Positives = 49/87 (55%), Gaps = 5/87 (5%)
 Frame = +2

Query: 1775 VTSMLSSVGFTEELLNKA-VGSLSGGWKMKLALARTMLMKPDIMLLDEPTNHLDVHNVKW 1951
            +T     VG   E+ N   +GSLSGG  +K+ +A  M   P +++LDEPTN+LD  ++  
Sbjct: 1011 ITKHFEDVGLDSEIANHTPLGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGA 1070

Query: 1952 L----EDYLVGLDEVSSIIVSHDSGFL 2020
            L     D+  G+     +++SH++ F+
Sbjct: 1071 LAVAIRDWSGGV-----VMISHNNEFV 1092

 Score = 40.8 bits (94), Expect(3) = e-148
 Identities = 18/48 (37%), Positives = 31/48 (64%)
 Frame = +1

Query: 784 NRDINAMVPLIIRSINHPEEVQETVHKLASTTFVQAVEAPALAMMVPL 927
           N D++    LI+ ++  P +V E+V  L+S TFV  V  P+L+++VP+
Sbjct: 342 NLDLSPRYKLIVDTLQDPSKVPESVKSLSSVTFVAEVTEPSLSLLVPI 389

>ref|NP_593609.1| putative translation elongation factor [Schizosaccharomyces pombe]
            gi|26393280|sp|O14134|ELF1_SCHPO mRNA export factor elf1
            gi|7493086|pir||T38694 probable translation elongation
            factor - fission yeast  (Schizosaccharomyces pombe)
            gi|2462683|emb|CAB16738.1| SPAC3C7.08c
            [Schizosaccharomyces pombe]
          Length = 1057

 Score =  270 bits (689), Expect(4) = e-144
 Identities = 139/273 (50%), Positives = 182/273 (65%), Gaps = 6/273 (2%)
 Frame = +3

Query: 2022 DHVCTHIIDYNN-----RKLRVYKGNLSKFVEQKPEAKAYYELTASTLTFKLPEPGYLEG 2186
            DHVCT II Y       +KL  Y+GNLS FV+ KPEAK+YY LTA+   F  P PG L G
Sbjct: 624  DHVCTDIIHYEGVKNQAKKLGYYQGNLSAFVKVKPEAKSYYTLTATNEKFVFPPPGILTG 683

Query: 2187 VKTKDKAILKADRVSYKYPNTDRMIFEGATAYCTLSSRVACIGPNGAGKSTLIKVLTGEV 2366
            V++  + ILK    SY YPN  +   +  T   +LSSRVA +GPNGAGKSTLIKVL GEV
Sbjct: 684  VRSNTRLILKMTNASYTYPNAKKKSLDNVTVGLSLSSRVAILGPNGAGKSTLIKVLIGEV 743

Query: 2367 EPVAGTVWKHPNLRIAYVAQHAFHHLEKHLDKTPNEYIQWRFAPGEDREAQEKETR-LTE 2543
             P  G V+KHPNLR+ YVAQHAFHHL++HL+KTP++YIQWR+A G+DRE  EKE+R LTE
Sbjct: 744  IPQEGKVFKHPNLRVGYVAQHAFHHLDQHLEKTPSQYIQWRYAGGQDREVSEKESRKLTE 803

Query: 2544 EEQKKLQENKVQIGDDPKVKRSVEKLLARRKLKKSYEYEVQWANTAADQTSWLPRDTLVE 2723
            E++ +LQ +    G+    +R VE L+ R+KLKKS++YE++W        +W+ R+ L+E
Sbjct: 804  EDRAQLQRDITVNGE----RRRVEALIGRQKLKKSFQYEIKWFGKPHKYNTWVSREILLE 859

Query: 2724 LGYEKLVNELDIKEAAALGLFTRPLTTASIQKH 2822
             G++K V   D  E++  GL  R L    I+ H
Sbjct: 860  NGFQKFVQAFDDMESSREGLGFRELIPEDIRAH 892

 Score =  234 bits (596), Expect(4) = e-144
 Identities = 142/351 (40%), Positives = 199/351 (56%), Gaps = 8/351 (2%)
 Frame = +2

Query: 992  DNMAKLVDNPAEALVFLPRLMPEIEKVANEAADPELRKVSNSAIKTLQHIETEGKAKLA- 1168
            DN+ KLV +PAEA  FLP L+P++E++A  AA PE+R +++ A+ TL        AK A 
Sbjct: 280  DNLCKLVPDPAEASDFLPELIPDVERIAQTAAMPEVRALASHALTTLNKAAAAQAAKAAN 339

Query: 1169 ----KTLDKVLPP*RPCTTCWRPPPRARRAWSPRPTPCWTTPPPCAANLTNNKNFEIEEW 1336
                + LD      R         P    A S     C        A L  + NF+ ++W
Sbjct: 340  NSEKQALDSACKELREAVLKNTSVPH-ELANSIIDYVC-----DALAALYKSNNFDKDKW 393

Query: 1337 RDKVIGTYLGVFVSKDTLAPIAQTLADKCFAEVQ-VKSTEYFDDE--EGEELCNCEFSLA 1507
              ++   YL   V ++  + I+  + D   A  + + S +   +   E EEL N +FSLA
Sbjct: 394  TSQLGVLYLSPLVGEELASQISSKIYDDLHAFYKSLNSVDGISNLTIEEEELVNTDFSLA 453

Query: 1508 YGAKILLNNAALRLKRGRRYGLCGPNGVGKSTLMRAIANGQVDGFPPKDVLRTVYVEHDI 1687
            YG ++LL++  L L RG RYG+ G NG GKSTL+RAI + +V+ FP  D ++T +V H +
Sbjct: 454  YGGRLLLSHTNLHLYRGHRYGVVGHNGCGKSTLLRAIGDYKVENFPSPDEVKTCFVAHSL 513

Query: 1688 DGSLSDLNCVEFVFADENLQAAVNTTKEQVTSMLSSVGFTEELLNKAVGSLSGGWKMKLA 1867
             G  + +  ++FV  D+ L   +N T+++    L SVGFT E+    V SLSGGWKMKL 
Sbjct: 514  QGEDTSMAILDFVAQDKAL-LTMNVTRQEAADALHSVGFTAEMQENPVASLSGGWKMKLE 572

Query: 1868 LARTMLMKPDIMLLDEPTNHLDVHNVKWLEDYLVGLDEVSSIIVSHDSGFL 2020
            LAR ML K DI+LLDEPTNHLDV N+ WLE YL     ++ +IVSHDS FL
Sbjct: 573  LARAMLQKADILLLDEPTNHLDVANIAWLEAYLTSQKNITCLIVSHDSSFL 623

 Score = 44.3 bits (103), Expect = 0.012
 Identities = 32/112 (28%), Positives = 55/112 (48%), Gaps = 7/112 (6%)
 Frame = +2

Query: 1769 EQVTSMLSSVGFTEELLNKA-VGSLSGGWKMKLALARTMLMKPDIMLLDEPTNHLDVHNV 1945
            E + +    VG   ++ + + + SLSGG K+K+ +A  +   P +++LDEPTN LD    
Sbjct: 887  EDIRAHFEDVGLPGDIADYSPISSLSGGQKVKVVIAACLWNNPQLLVLDEPTNFLD---- 942

Query: 1946 KWLEDYLVGLD------EVSSIIVSHDSGFLRPRVHAHHRLQQPQAARVQGQ 2083
                D L GL       E   +++SH+  F+      H  +   +A +V G+
Sbjct: 943  ---RDALGGLAVAIRDWEGGVVMISHNEEFVSALCPEHWHV---EAGKVTGK 988

 Score = 43.5 bits (101), Expect(4) = e-144
 Identities = 19/48 (39%), Positives = 32/48 (66%)
 Frame = +1

Query: 784 NRDINAMVPLIIRSINHPEEVQETVHKLASTTFVQAVEAPALAMMVPL 927
           N DI   +P ++  + HPE ++  +  L++TTFV  VE+ ALA++VP+
Sbjct: 212 NNDIIPHIPKLVDCMAHPETLEACIKDLSATTFVATVESVALAVLVPI 259

 Score = 35.0 bits (79), Expect(4) = e-144
 Identities = 30/117 (25%), Positives = 51/117 (42%), Gaps = 5/117 (4%)
 Frame = +3

Query: 444 PCCPPCWSSAVTRSPR*RPPLSAASKALISIINPHAVYT-----ILGYLFECMDAKKHPA 608
           P  P    S   R    R     A++AL+  +   AV T     ++ YL +   + K P+
Sbjct: 97  PYLPTILDSFSDRGEVVRQAAKMAAQALLDCLPAGAVETRLIPSLISYLDD--SSIKWPS 154

Query: 609 TKEASLLLVKQLVGMHPKQITRALPDIVPAVSGCMNDSKQSVKDVATETMKEACTLV 779
            K A+L L+  L    PK +   +  ++P +   M+D+K  +   A   M   C++V
Sbjct: 155 -KVAALQLLGSLASSSPKAVADYMAALIPCIKERMHDTKPEISRAAITCMLNLCSVV 210

>ref|NP_014384.1| Translational elongation factor EF-3B; Hef3p [Saccharomyces
            cerevisiae] gi|1706591|sp|P53978|EF3B_YEAST Elongation
            factor 3B (EF-3B) gi|2119783|pir||S62926 probable
            membrane protein YNL014w - yeast (Saccharomyces
            cerevisiae) gi|1301836|emb|CAA95874.1| unnamed protein
            product [Saccharomyces cerevisiae]
          Length = 1044

 Score =  279 bits (713), Expect(2) = e-144
 Identities = 167/371 (45%), Positives = 221/371 (59%), Gaps = 5/371 (1%)
 Frame = +2

Query: 923  PWLLRGLRERVTCHQAQWPPWWRDNMAKLVDNPAEALVFLPRLMPEIEKVANEAADPELR 1102
            P L RGL ER T  + +      DNM KLV++P     FL +L+P ++      ADPE R
Sbjct: 249  PLLSRGLAERETSIKRK-AAVIIDNMCKLVEDPQVVAPFLGKLLPGLKNNFATIADPEAR 307

Query: 1103 KVSNSAIKTLQHIETEGKAKLAKTLDKVLPP*RPCTTCWRPPPRARRAWSP-RPTPCWTT 1279
            +V+  A+KTL+ +   G+       D VLP               +    P +  P +T 
Sbjct: 308  EVTLKALKTLRRVGNVGE-------DDVLPEISHAGDVSTTLGVIKELLEPEKVAPRFTI 360

Query: 1280 P----PPCAANLTNNKNFEIEEWRDKVIGTYLGVFVSKDTLAPIAQTLADKCFAEVQVKS 1447
                    AANL + +  + + W   V   Y+ +F+ + T   I      +    + V  
Sbjct: 361  VVEYIAAIAANLIDERIIDQQTWFTHVT-PYMTIFLHEKTAKEILDDFRKRAVDNIPVGP 419

Query: 1448 TEYFDDEEGEELCNCEFSLAYGAKILLNNAALRLKRGRRYGLCGPNGVGKSTLMRAIANG 1627
                +++EGE+LCNCEFSLAYGAKILLN   LRLKRGRRYGLCGPNG GKSTLMR+IANG
Sbjct: 420  NFQDEEDEGEDLCNCEFSLAYGAKILLNKTQLRLKRGRRYGLCGPNGAGKSTLMRSIANG 479

Query: 1628 QVDGFPPKDVLRTVYVEHDIDGSLSDLNCVEFVFADENLQAAVNTTKEQVTSMLSSVGFT 1807
            QVDGFP +D  RTVYVEHDID + SD++ ++FV++          TK+ +TS L   GF+
Sbjct: 480  QVDGFPTQDECRTVYVEHDIDNTHSDMSVLDFVYSGN------VGTKDVITSKLKEFGFS 533

Query: 1808 EELLNKAVGSLSGGWKMKLALARTMLMKPDIMLLDEPTNHLDVHNVKWLEDYLVGLDEVS 1987
            +E++   + SLSGGWKMKLALAR +L   DI+LLDEPTNHLD  NV+WL +YL     ++
Sbjct: 534  DEMIEMPIASLSGGWKMKLALARAVLKDADILLLDEPTNHLDTVNVEWLVNYL-NTCGIT 592

Query: 1988 SIIVSHDSGFL 2020
            S+IVSHDSGFL
Sbjct: 593  SVIVSHDSGFL 603

 Score =  259 bits (661), Expect(2) = e-144
 Identities = 138/280 (49%), Positives = 175/280 (62%), Gaps = 13/280 (4%)
 Frame = +3

Query: 2022 DHVCTHIIDYNNRKLRVYKGNLSKFVEQKPEAKAYYELTASTLTFKLPEPGYLEGVKTKD 2201
            D VC +II Y   KLR YKGNLS+FV++ P A++YYEL AS L F+ P PGYLEGVKTK 
Sbjct: 604  DKVCQYIIHYEGLKLRKYKGNLSEFVQKCPTAQSYYELGASDLEFQFPTPGYLEGVKTKQ 663

Query: 2202 KAILKADRVSYKYPNTDRMIFEGATAYCTLSSRVACIGPNGAGKSTLIKVLTGEVEPVAG 2381
            KAI+K   ++++YP T +      T  C+LSSR+A IGPNGAGKSTLI VLTGE+ P +G
Sbjct: 664  KAIVKVSNMTFQYPGTTKPQVSDVTFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSG 723

Query: 2382 TVWKHPNLRIAYVAQHAFHHLEKHLDKTPNEYIQWRFAPGEDREAQEKETRLTEEEQKKL 2561
             V+ H N RIAY+ QHAF H+E HLDKTP+EYIQWRF  GEDRE  ++  R   E   + 
Sbjct: 724  EVYTHENCRIAYIKQHAFAHIESHLDKTPSEYIQWRFQTGEDRETMDRANRQINENDAEA 783

Query: 2562 QENKVQIGDDPKVKRSVEKLLARRKLKKSYEYEV-------------QWANTAADQTSWL 2702
                 +I   P   R V  + +RRK K +YEYE              +W    +   +WL
Sbjct: 784  MNKIFKIEGTP---RRVAGIHSRRKFKNTYEYECSFLLGENIGMKSERWVPMMSVDNAWL 840

Query: 2703 PRDTLVELGYEKLVNELDIKEAAALGLFTRPLTTASIQKH 2822
            PR  L+E  + K+V E+D+KEA A G F R LT   I+ H
Sbjct: 841  PRGELIE-SHSKMVAEIDMKEALASGQF-RALTRKEIELH 878

 Score = 55.1 bits (131), Expect(2) = 2e-15
 Identities = 38/122 (31%), Positives = 61/122 (49%), Gaps = 4/122 (3%)
 Frame = +3

Query: 426 LSPSWPP----CCPPCWSSAVTRSPR*RPPLSAASKALISIINPHAVYTILGYLFECMDA 593
           LSPS  P      P   S A ++    +   + A KA+ S +NP AV  +L +L   ++ 
Sbjct: 80  LSPSVEPYIVATVPSVCSKAGSKDNDVQLAATKALKAIASAVNPVAVKALLPHLIHSLET 139

Query: 594 KKHPATKEASLLLVKQLVGMHPKQITRALPDIVPAVSGCMNDSKQSVKDVATETMKEACT 773
                 K A L ++  LV    +QI   +P+++P +S  M D+K+ VK+ AT T+ +A  
Sbjct: 140 SNKWKEKVAVLEVISVLVDAAKEQIALRMPELIPVLSESMWDTKKGVKEAATTTITKATE 199

Query: 774 LV 779
            V
Sbjct: 200 TV 201

 Score = 52.4 bits (124), Expect(2) = 2e-15
 Identities = 29/68 (42%), Positives = 39/68 (56%)
 Frame = +1

Query: 784 NRDINAMVPLIIRSINHPEEVQETVHKLASTTFVQAVEAPALAMMVPLAAARSARARDLP 963
           N+DI   +P +I  I +P EV ETVH L +TTFV  V    L++MVPL  +R    R+  
Sbjct: 203 NKDIERFIPKLIECIANPNEVPETVHLLGATTFVAEVTPATLSIMVPL-LSRGLAERETS 261

Query: 964 SSAMAAVV 987
               AAV+
Sbjct: 262 IKRKAAVI 269

 Score = 49.3 bits (116), Expect = 4e-04
 Identities = 29/88 (32%), Positives = 51/88 (57%), Gaps = 1/88 (1%)
 Frame = +2

Query: 1763 TKEQVTSMLSSVGFTEELLNKA-VGSLSGGWKMKLALARTMLMKPDIMLLDEPTNHLDVH 1939
            T++++    + +G   EL++ + +  LSGG K+KL LA     +P +++LDEPTN+LD  
Sbjct: 871  TRKEIELHCAMLGLDSELVSHSRIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLDRD 930

Query: 1940 NVKWLEDYLVGLDEVSSIIVSHDSGFLR 2023
            ++  L   L    E   II++H + F +
Sbjct: 931  SLGALSKALKAF-EGGVIIITHSAEFTK 957



EST assemble image


clone accession position
1 HCL084c01_r AV644219 1 594
2 HCL062e11_r AV643032 2 544
3 HCL087g08_r AV644396 6 589
4 MXL074a02_r BP097331 10 497
5 HCL078d07_r AV643919 10 614
6 HCL064f07_r AV643147 10 611
7 MXL084h09_r BP097994 17 499
8 HCL079h12_r AV644002 17 583
9 HCL089g10_r AV644513 22 662
10 HCL089f05_r AV644502 31 614
11 MXL041c09_r BP095405 33 545
12 HCL056a09_r AV642684 100 587
13 HCL062b03_r AV643008 102 593
14 MXL038c06_r BP095221 102 276
15 HCL056h07_r AV642732 102 604
16 HCL021h05_r AV640756 102 490
17 MXL040g03_r BP095369 102 523
18 HCL027b08_r AV641065 102 587
19 MXL011a07_r BP093618 102 586
20 HCL037g04_r AV641627 102 581
21 MXL095b06_r BP098544 102 594
22 HCL053c08_r AV642524 102 598
23 MXL003g08_r BP093126 103 448
24 MXL046h06_r BP095753 103 549
25 MXL064c01_r BP096749 103 611
26 MXL001e07_r BP092966 103 569
27 HCL016e08_r AV640451 103 579
28 HCL047h03_r AV642229 103 586
29 HCL073d10_r AV643652 103 592
30 MXL029g11_r BP094796 104 591
31 MXL091d12_r BP098319 104 494
32 LCL048g12_r AV628909 105 325
33 HCL062a02_r AV643003 105 651
34 HCL065c07_r AV643188 105 594
35 LCL093c07_r AV631401 105 349
36 MXL002d12_r BP093035 106 438
37 MXL029e07_r BP094780 106 572
38 HCL038f08_r AV641685 106 417
39 HCL059b04_r AV642842 106 571
40 HCL091e04_r AV644630 106 660
41 HCL082b06_r AV644111 106 661
42 HCL038f06_r AV641683 106 351
43 HCL079c08_r AV643966 106 598
44 HCL061e06_r AV642976 107 605
45 HCL009g03_r AV640069 108 302
46 HCL032c09_r AV641363 108 500
47 MXL066d12_r BP096885 108 611
48 MXL098a12_r BP098728 108 488
49 HCL095c04_r AV644898 108 660
50 HCL039f01_r AV641740 108 426
51 HCL053f10_r AV642544 108 599
52 HCL039g07_r AV641753 108 580
53 MXL065d06_r BP096818 108 600
54 MXL071a07_r BP097158 108 487
55 MXL063h03_r BP096729 108 506
56 MXL024g10_r BP094551 108 539
57 MXL031a02_r BP094847 108 538
58 HCL061b01_r AV642950 108 659
59 HCL054b09_r AV642579 108 614
60 HCL065h10_r AV643224 108 612
61 HCL067c05_r AV643302 108 556
62 HCL006g09_r AV639893 108 467
63 HCL097b03_r AV645022 108 574
64 HCL002d12_r AV639654 108 597
65 HCL031g07_r AV641331 108 657
66 MXL054c04_r BP096186 108 569
67 MXL049f03_r BP095931 108 503
68 MXL019b07_r BP094177 108 650
69 MXL020c05_r BP094262 108 661
70 HCL008f03_r AV640002 109 649
71 MXL027a05_r BP094675 109 295
72 HCL099d03_r AV645187 110 490
73 HCL056f01_r AV642715 111 600
74 MXL075b02_r BP097400 111 490
75 HCL063d12_r AV643083 111 639
76 MXL022b10_r BP094373 111 650
77 MXL064f08_r BP096775 111 526
78 HCL092h10_r AV644724 111 481
79 HCL093a08_r AV644730 111 577
80 HCL048g08_r AV642272 111 375
81 HCL002g06_r AV639669 112 660
82 HCL078e01_r AV643921 113 594
83 HCL023c08_r AV640843 113 590
84 MXL037e05_r BP095188 113 561
85 MXL062a01_r BP096624 113 515
86 HCL031e01_r AV641312 113 587
87 MXL078a02_r BP097575 113 507
88 MXL099d05_r BP098804 113 573
89 HCL088e06_r AV644437 113 581
90 MXL009d11_r BP093513 113 357
91 HCL067d01_r AV643308 113 614
92 HCL050c11_r AV642354 113 597
93 HCL090a02_r AV644519 113 530
94 MXL023g01_r BP094478 113 660
95 HCL013e01_r AV640271 113 347
96 MXL057c05_r BP096351 113 525
97 HCL067b10_r AV643296 114 603
98 HCL025d04_r AV640958 114 660
99 HCL023b01_r AV640831 114 538
100 HCL086c07_r AV644321 114 583
101 MXL002h09_r BP093067 114 581
102 MXL063f10_r BP096718 114 600
103 HCL093c01_r AV644745 114 580
104 MXL025e02_r BP094599 114 489
105 HCL049e07_r AV642311 114 584
106 HCL034g03_r AV641495 114 579
107 HCL069b01_r AV643403 114 589
108 MXL016b04_r BP093948 114 302
109 MXL054g04_r BP096216 114 487
110 MXL029a02_r BP094762 114 277
111 HCL033e01_r AV641429 114 504
112 HCL055a01_r AV642624 114 655
113 HCL006c06_r AV639861 114 594
114 HCL007b10_r AV639916 114 548
115 MXL001b01_r BP092938 114 505
116 HCL100f01_r AV645281 114 307
117 HCL036c07_r AV641559 114 661
118 HCL081f12_r AV644095 114 657
119 HCL067d08_r AV643313 116 504
120 MXL069e08_r BP097069 116 591
121 HCL018c11_r AV640560 116 661
122 MXL061c02_r BP096587 116 611
123 HCL007d01_r AV639928 116 580
124 MXL093a06_r BP098417 116 490
125 HCL007c09_r AV639925 116 587
126 MXL016e06_r BP093979 116 589
127 HCL010d11_r AV640102 116 488
128 HCL034b06_r AV641467 116 660
129 MXL042g11_r BP095502 116 516
130 HCL006f12_r AV639887 116 351
131 HCL069g12_r AV643446 116 614
132 HCL100h07_r AV645308 116 533
133 CL07e04_r AV393448 117 611
134 HCL066h12_r AV643283 118 591
135 HCL051c11_r AV642409 118 611
136 MXL002h12_r BP093070 118 538
137 MXL055g03_r BP096269 118 507
138 HCL069g07_r AV643442 120 661
139 HCL076f03_r AV643816 120 599
140 HCL064h12_r AV643168 120 613
141 HCL088a10_r AV644412 120 570
142 HCL050a03_r AV642337 120 614
143 MXL076f05_r BP097490 120 611
144 CL11d08_r AV393778 120 660
145 HCL069d07_r AV643421 120 605
146 HCL019g06_r AV640647 120 345
147 HCL088e07_r AV644438 120 688
148 HCL022c07_r AV640778 120 537
149 HCL090g04_r AV644572 121 537
150 HCL094a02_r AV644800 121 538
151 MXL087c08_r BP098111 121 492
152 MXL004b06_r BP093148 121 417
153 HCL093f08_r AV644779 121 661
154 HCL079b05_r AV643959 122 615
155 HCL074f02_r AV643710 122 610
156 HCL087b08_r AV644368 122 613
157 HCL025h06_r AV640995 122 652
158 HCL075a02_r AV643730 122 614
159 CL40b09_r AV395345 122 593
160 HCL073d07_r AV643651 122 615
161 HCL055g06_r AV642670 122 633
162 HCL099h01_r AV645222 123 504
163 CL09f02_r AV393748 125 672
164 CL73f05_r AV396971 129 613
165 HCL042f05_r AV641933 131 538
166 HCL068d07_r AV643364 131 614
167 HCL068e07_r AV643374 131 611
168 MXL035b03_r BP095056 131 609
169 HCL035e06_r AV641527 131 660
170 HCL025b01_r AV640942 131 552
171 MXL098e11_r BP098754 131 494
172 MXL069g04_r BP097084 131 594
173 HCL004a02_r AV639734 131 374
174 HCL011b01_r AV640139 131 376
175 HCL005b05_r AV639793 131 385
176 HCL069g01_r AV643440 131 604
177 MXL059b09_r BP096464 131 519
178 HCL057f02_r AV642769 131 614
179 HCL099h02_r AV645223 133 410
180 HCL038c09_r AV641661 133 567
181 MXL041c02_r BP095398 133 600
182 HCL091b11_r AV644608 135 565
183 HCL003a08_r AV639683 136 357
184 HCL019b09_r AV640610 138 368
185 HCL051f04_r AV642431 141 557
186 MXL036b02_r BP095116 142 660
187 HCL067f01_r AV643323 146 614
188 MXL003g07_r BP093125 149 399
189 HCL016d07_r AV640446 162 660
190 HCL088h03_r AV644455 168 725
191 HCL070d02_r AV643479 173 717
192 HCL081a07_r AV644060 175 639
193 MXL027d12_r BP094687 192 521
194 MXL067h04_r BP096964 199 604
195 MXL006e03_r BP093305 202 466
196 MXL040c04_r BP095343 280 698
197 MXL046a09_r BP095702 281 680
198 MXL083c09_r BP097907 285 635
199 MXL092h11_r BP098411 285 796
200 MXL091c08_r BP098310 287 894
201 MXL043h11_r BP095565 291 796
202 MXL044e07_r BP095607 292 792
203 HCL050f12_r AV642372 292 782
204 HCL008b06_r AV639973 298 820
205 MXL017f03_r BP094061 298 807
206 HCL031c08_r AV641300 302 804
207 MXL007b08_r BP093344 302 723
208 MXL087g10_r BP098132 311 674
209 MXL019e01_r BP094200 316 790
210 HCL006a01_r AV639840 317 818
211 HCL039f09_r AV641744 317 820
212 HCL069c10_r AV643415 318 867
213 MXL019d04_r BP094192 321 859
214 MXL018a06_r BP094091 323 664
215 HCL024f05_r AV640917 323 790
216 MXL016f09_r BP093993 323 858
217 MXL066g01_r BP096898 335 725
218 MXL038f08_r BP095240 335 781
219 HCL023b10_r AV640837 360 651
220 HCL039h03_r AV641760 360 949
221 MXL056b08_r BP096296 361 753
222 MXL017d05_r BP094043 373 700
223 HCL047d01_r AV642201 376 884
224 HCL053b02_r AV642512 387 944
225 CL14b04_r AV393856 390 925
226 MXL094a10_r BP098484 392 758
227 MXL070f02_r BP097130 397 760
228 MXL044h02_r BP095628 398 808
229 MXL007g01_r BP093386 400 713
230 MXL042h02_r BP095505 402 803
231 MXL052h12_r BP096115 403 791
232 MXL004g03_r BP093186 403 687
233 MXL075b01_r BP097399 403 908
234 MXL016h11_r BP094011 407 756
235 MXL081e04_r BP097798 407 875
236 MXL063c06_r BP096695 408 733
237 MXL026e07_r BP094655 408 616
238 MXL080h04_r BP097758 408 818
239 MXL017c03_r BP094034 412 803
240 MXL061a02_r BP096574 421 924
241 LCL045b07_r AV628653 433 902
242 MXL080h12_r BP097762 436 831
243 MXL093f09_r BP098461 436 822
244 MXL071e01_r BP097186 448 964
245 MXL036f11_r BP095150 457 893
246 MXL010d05_r BP093575 466 807
247 MXL048b07_r BP095838 468 961
248 MXL082e12_r BP097864 470 870
249 MXL038e08_r BP095233 479 966
250 MXL055h12_r BP096285 479 930
251 MXL002d11_r BP093034 479 875
252 HCL098g04_r AV645142 488 883
253 HCL047e07_r AV642211 491 734
254 MXL076g02_r BP097496 509 970
255 HCL084d09_r AV644231 520 1052
256 MXL005a08_r BP093212 535 1036
257 MXL044f08_r BP095617 537 940
258 HCL061b03_r AV642951 541 1077
259 MXL051d12_r BP096033 546 1008
260 MXL075g01_r BP097439 547 954
261 MXL085e05_r BP098024 547 1017
262 HCL039e08_r AV641736 555 1103
263 CL51d05_r AV395911 567 1113
264 MXL072g11_r BP097271 596 1018
265 HCL066a03_r AV643228 596 1110
266 LCL046e05_r AV628744 599 1037
267 MXL070e05_r BP097124 601 998
268 MXL042g06_r BP095499 602 1113
269 MXL064a10_r BP096738 602 1022
270 MXL089h11_r BP098239 615 1113
271 CL75b07_r AV397101 621 859
272 MXL059d08_r BP096482 628 1123
273 MXL010c06_r BP093569 634 893
274 MXL010b06_r BP093561 637 820
275 MXL016h04_r BP094006 642 1195
276 MXL056c06_r BP096302 650 1076
277 MXL007a04_r BP093333 658 963
278 MXL007e07_r BP093373 664 1162
279 MXL087f05_r BP098123 671 1066
280 HCL032b08_r AV641355 682 1105
281 MXL008a05_r BP093410 686 1174
282 HCL062g12_r AV643046 692 944
283 MXL050b07_r BP095962 697 1110
284 MXL072b12_r BP097233 697 1116
285 MXL079d04_r BP097669 710 837
286 LCL022b09_r AV627172 713 1191
287 MXL073g02_r BP097320 714 1113
288 MXL002g10_r BP093061 725 1194
289 HCL089a09_r AV644464 730 1246
290 MXL069h11_r BP097095 733 901
291 HCL004e09_r AV639760 734 1036
292 CL28a06_r AV394794 739 1336
293 HCL043g02_r AV642003 740 1336
294 LCL100a07_r AV631798 741 1306
295 HCL024f03_r AV640915 743 1187
296 MXL001e04_r BP092964 744 1076
297 MXL059g05_r BP096501 744 1211
298 HCL031a09_r AV641285 746 1048
299 HCL023g01_r AV640863 748 1338
300 HCL100c08_r AV645256 774 1343
301 MXL018c08_r BP094108 775 1320
302 MXL027h03_r BP094709 779 1112
303 MXL022a12_r BP094366 789 1034
304 MXL095g05_r BP098576 789 1285
305 HCL082c08_r AV644119 798 1339
306 HCL091f10_r AV644645 799 1306
307 HCL064g12_r AV643158 811 1342
308 HCL045a05_r AV642069 811 1112
309 HCL090d01_r AV644546 811 1242
310 MXL041g11_r BP095438 819 1263
311 MXL011e04_r BP093650 828 1135
312 MXL039d02_r BP095285 858 1294
313 MXL099a11_r BP098783 874 1289
314 MXL014f01_r BP093843 881 1332
315 MXL057f01_r BP096366 883 1416
316 MXL067d03_r BP096939 885 1319
317 HCL028h11_r AV641163 892 1338
318 MXL015d06_r BP093905 897 1307
319 HCL097b05_r AV645024 898 1485
320 HCL067h03_r AV643339 898 1396
321 HCL003a01_r AV639679 904 1515
322 MXL012a09_r BP093688 907 1189
323 CL38b11_r AV395325 931 1545
324 MXL062c07_r BP096645 932 1473
325 MXL077d03_r BP097530 939 1387
326 LCL079g03_r AV630494 956 1122
327 MXL039e05_r BP095295 957 1416
328 MXL024f09_r BP094541 957 1281
329 MXL074a08_r BP097334 958 1422
330 MXL004b09_r BP093150 958 1330
331 CL07c03_r AV393455 960 1512
332 MXL035h03_r BP095101 962 1302
333 LCL051h09_r AV629094 963 1528
334 MXL073e05_r BP097313 965 1480
335 CL55f11_r AV396061 965 1563
336 MXL091d07_r BP098316 966 1532
337 HCL057a08_r AV642738 968 1537
338 MXL001b04_r BP092939 970 1334
339 HCL018c05_r AV640556 976 1590
340 LCL079b05_r AV630458 985 1097
341 MXL076a01_r BP097453 986 1482
342 HCL091f06_r AV644642 1000 1528
343 MXL038f11_r BP095243 1001 1408
344 HCL008h05_r AV640018 1002 1516
345 HCL047a09_r AV642185 1003 1302
346 MXL091f03_r BP098328 1005 1538
347 MXL034g10_r BP095037 1011 1526
348 HCL032c12_r AV641365 1017 1465
349 HCL033c03_r AV641415 1022 1465
350 HCL053a02_r AV642504 1036 1563
351 MXL003f12_r BP093119 1043 1302
352 HCL100a05_r AV645234 1050 1604
353 HCL053d02_r AV642528 1087 1617
354 LCL032a03_r AV627784 1123 1481
355 MXL085a12_r BP098000 1127 1566
356 HCL009b03_r AV640030 1138 1727
357 HCL064b12_r AV643125 1141 1685
358 MXL016a04_r BP093940 1148 1529
359 LCL036d11_r AV628084 1166 1679
360 HCL042c01_r AV641903 1177 1660
361 HCL004h01_r AV639775 1177 1565
362 HCL011f10_r AV640178 1179 1372
363 HCL070f07_r AV643496 1179 1692
364 MXL094e12_r BP098519 1180 1538
365 HCL047g12_r AV642227 1186 1487
366 HCL013g05_r AV640288 1200 1590
367 MXL001g07_r BP092983 1211 1625
368 MXL071c06_r BP097175 1211 1643
369 CL54e04_r AV396137 1215 1766
370 CL67a04_r AV396688 1221 1771
371 MXL070a05_r BP097099 1221 1654
372 HCL038e05_r AV641675 1224 1720
373 HCL092e02_r AV644699 1231 1614
374 HCL037h11_r AV641642 1239 1723
375 MXL011b02_r BP093624 1251 1580
376 MXL051b12_r BP096021 1254 1713
377 HCL042g02_r AV641937 1254 1721
378 MXL077a10_r BP097510 1254 1661
379 LCL046c08_r AV628731 1263 1774
380 HCL095e12_r AV644924 1264 1580
381 HCL062h08_r AV643051 1265 1768
382 HCL019e03_r AV640628 1266 1590
383 CL54h02_r AV396160 1266 1877
384 HCL038f02_r AV641680 1273 1710
385 HCL015e03_r AV640392 1281 1529
386 LCL085c09_r AV630857 1300 1545
387 MXL074a06_r BP097333 1304 1734
388 MXL096h01_r BP098643 1316 1710
389 HCL087d08_r AV644379 1319 1767
390 HCL090e01_r AV644554 1330 1719
391 MXL021a04_r BP094309 1350 1604
392 HCL090g03_r AV644571 1359 1720
393 HCL063b05_r AV643065 1379 1859
394 HCL023h03_r AV640870 1381 1705
395 HCL028f01_r AV641146 1404 1952
396 HCL023a03_r AV640824 1408 1940
397 HCL084c11_r AV644226 1439 1960
398 MXL025d10_r BP094596 1440 1924
399 HCL077a11_r AV643844 1443 1909
400 HCL094g01_r AV644855 1447 1842
401 HCL049c09_r AV642300 1447 1764
402 HCL040c02_r AV641787 1448 1962
403 HCL094d09_r AV644834 1463 1867
404 HCL049d07_r AV642304 1469 1586
405 LCL057g09_r AV629389 1470 1715
406 MXL078a01_r BP097574 1499 1879
407 HCL086h11_r AV644357 1505 2028
408 HCL005d03_r AV639811 1525 1962
409 HCL099d12_r AV645196 1558 1949
410 MXL024d09_r BP094524 1558 1697
411 HCL082b09_r AV644114 1560 2052
412 CL53a03_r AV395948 1561 2079
413 HCL003b11_r AV639693 1580 1836
414 HCL100h03_r AV645304 1611 2116
415 HCL042c06_r AV641908 1618 2072
416 HCL024e12_r AV640912 1643 1888
417 HCL065g02_r AV643212 1661 2189
418 MXL043a11_r BP095518 1787 2145
419 HC028f12_r AV634059 1976 2494
420 MXL055a08_r BP096236 2000 2472
421 MX223f07_r BP090417 2012 2312
422 MXL008h05_r BP093474 2036 2477
423 MXL100e04_r BP098870 2059 2435
424 MXL071h10_r BP097212 2084 2487
425 HCL096a12_r AV644963 2175 2631
426 HCL035h01_r AV641541 2295 2731
427 MXL077f06_r BP097552 2344 2790
428 MXL024g12_r BP094552 2365 2768
429 HC002f03_r AV631992 2587 3033
430 LCL063h04_r AV629692 2685 3051




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research