KCC000153A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000153A_C01 KCC000153A_c01
ggactgtgagctatggatcacatgctacgcgcattttaatcaatggcactaCGGTAGTAC
ATCCTGCATGACATGTCACGGACCTAAGCCTTGATTTGACGCTTGACGCAGCTTGCTGCG
GCCTGAACTACGACATATGCCTTGGTGTTTACTTGCCCTGACCAACACCTGTGTGAATGT
GAGGCGACCGGCGGCTTGCATGAAGCGAGTCTGCTCTGTACATGGTCCTGGACGTGTTTT
ACGTGCAATAATAGCAGTGTTATGGCTGCGTGACATACGGCTAATTGGTGGTGTTCAGGT
GTGTTGTGATGACCGGCTGTGCATGGCTGGACCGAGCGGACACCGGGCTGTCTATGCAAA
CGGCCGCTAGCTCTGTCCTGCCGGTGTGTTATGCCAGTTATGATGTGGGCGCAGCCAAGT
TTCTTGGAAAAGAATGACGTCGATTCGGAGTGCGGACATTGACTTGGTTTGGTTTTCGTA
CGCCTTCAAGGGCCCTGGTGTGTTCGCTT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000153A_C01 KCC000153A_c01
         (509 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAC47154.1| PsqB                                                    35  0.55
gb|AAC47153.1| PsqA                                                    35  0.55
sp|P42865|QOR_LEIAM POSSIBLE QUINONE OXIDOREDUCTASE (NADPH:QUINO...    35  0.71
pir||S66149 gene pipsqueak protein A long form - fruit fly (Dros...    31  1.4
emb|CAA62475.1| pipsqueak [Drosophila melanogaster]                    31  1.5

>gb|AAC47154.1| PsqB
          Length = 646

 Score = 35.0 bits (79), Expect = 0.55
 Identities = 26/90 (28%), Positives = 36/90 (39%), Gaps = 2/90 (2%)
 Frame = -1

Query: 392 ITHRQDRASGRLHRQ-PGVRSVQPCTAGHHNTPEHHQLAVCHAAITL-LLLHVKHVQDHV 219
           I H Q+ +   L +Q P   S  P T  HH+TP+HH  A         +  HV H+Q   
Sbjct: 536 IEHSQENSLHMLQQQFPYSPSPHPPTPQHHSTPQHHSSAQQGPPTPQHMQQHVVHMQQQQ 595

Query: 218 QSRLASCKPPVASHSHRCWSGQVNTKAYVV 129
           Q +     P    H        V + + VV
Sbjct: 596 QQQQQQQSPHPGHHPQHMQQDVVTSSSQVV 625

>gb|AAC47153.1| PsqA
          Length = 1065

 Score = 35.0 bits (79), Expect = 0.55
 Identities = 26/90 (28%), Positives = 36/90 (39%), Gaps = 2/90 (2%)
 Frame = -1

Query: 392  ITHRQDRASGRLHRQ-PGVRSVQPCTAGHHNTPEHHQLAVCHAAITL-LLLHVKHVQDHV 219
            I H Q+ +   L +Q P   S  P T  HH+TP+HH  A         +  HV H+Q   
Sbjct: 955  IEHSQENSLHMLQQQFPYSPSPHPPTPQHHSTPQHHSSAQQGPPTPQHMQQHVVHMQQQQ 1014

Query: 218  QSRLASCKPPVASHSHRCWSGQVNTKAYVV 129
            Q +     P    H        V + + VV
Sbjct: 1015 QQQQQQQSPHPGHHPQHMQQDVVTSSSQVV 1044

>sp|P42865|QOR_LEIAM POSSIBLE QUINONE OXIDOREDUCTASE (NADPH:QUINONE REDUCTASE) (P36)
           gi|308883|gb|AAA73554.1| zeta-crystallin
           NADPH-oxidoreductase
          Length = 340

 Score = 34.7 bits (78), Expect = 0.71
 Identities = 22/68 (32%), Positives = 32/68 (46%), Gaps = 2/68 (2%)
 Frame = -1

Query: 449 SESTSFFSKKLGCAHIITGITHRQDRASGRLHR--QPGVRSVQPCTAGHHNTPEHHQLAV 276
           SE  + F K +GC H+   I ++ +   GRLH     GV  V  C  GH        +AV
Sbjct: 180 SEEKAEFLKSIGCDHV---INYKTESLDGRLHELCPKGVDVVYECVGGHTFNDAVRHVAV 236

Query: 275 CHAAITLL 252
            HA + ++
Sbjct: 237 -HARVVII 243

>pir||S66149 gene pipsqueak protein A long form - fruit fly (Drosophila
            melanogaster) gi|1149500|emb|CAA62474.1| pipsqueak
            [Drosophila melanogaster]
          Length = 1085

 Score = 30.8 bits (68), Expect(2) = 1.4
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = -1

Query: 392  ITHRQDRASGRLHRQ-PGVRSVQPCTAGHHNTPEHHQLA 279
            I H Q+ +   L +Q P   S  P T  HH+TP+HH  A
Sbjct: 955  IEHSQENSLHMLQQQFPYSPSPHPPTPQHHSTPQHHSSA 993

 Score = 21.6 bits (44), Expect(2) = 1.4
 Identities = 8/18 (44%), Positives = 11/18 (60%)
 Frame = -2

Query: 187  SPHIHTGVGQGK*TPRHM 134
            +P  H+   QG  TP+HM
Sbjct: 986  TPQHHSSAQQGPPTPQHM 1003

>emb|CAA62475.1| pipsqueak [Drosophila melanogaster]
          Length = 660

 Score = 30.8 bits (68), Expect(2) = 1.5
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = -1

Query: 392 ITHRQDRASGRLHRQ-PGVRSVQPCTAGHHNTPEHHQLA 279
           I H Q+ +   L +Q P   S  P T  HH+TP+HH  A
Sbjct: 530 IEHSQENSLHMLQQQFPYSPSPHPPTPQHHSTPQHHSSA 568

 Score = 21.6 bits (44), Expect(2) = 1.5
 Identities = 8/18 (44%), Positives = 11/18 (60%)
 Frame = -2

Query: 187 SPHIHTGVGQGK*TPRHM 134
           +P  H+   QG  TP+HM
Sbjct: 561 TPQHHSSAQQGPPTPQHM 578



EST assemble image


clone accession position
1 CL07c01_r AV393485 1 509
2 CL80e04_r AV397321 52 508




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research