KCC000152A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000152A_C01 KCC000152A_c01
cggacgggagctagcaCAACAATATTCACATCTACCTATACTTTCATATCTGCCTCCACC
GGGACTGACACCAGCTTCGCGACGAGTCAGCAAATTTGAGTTGCTCTCGTTCCGGAGTGC
CCGCTTAGCTTTTATACTTCAACATGTCAACCACATGCATTCAAGCGAAGTTCCCGGGCG
CCAGGTTGCGCAACACACGATGCAGCAACTCCCGCCCCGTCTCGCGGGCTCGCATGGCTG
TCGTGAGACCAGTGGCATACCTTCATGCTGGACAGACAGAGCAACGGAGGCGCTACGATG
CCGAGTTCACCATGATGAGCAGCCGACTCGGTGGAGTGGTGCATCAGGCTGTGGCCGCGG
CCGTGTGCAACGGCGTCTGGCCGCGCCAGCCCCTGCCCTTCCCCTCGCTGGCCAGCGCCC
CCCCTGCCCAGCAGCACCAGCACCAGCAAGACTATGCATCCGGCAGCGCCGCGAGTGGCG
GCGGCTCGGGCGCGGGCGCGGGCTCGCCGACGGGCCTTGCGTCGGCGCTGCTGCGGTGCC
TGGAGGACCAGCTGCAGGCCAAGAAGTTTGAGGGCGGCGCTGACGAGGCCGCCGACGTGC
TGTCAGGCTTCGCCAGCGCCTCCCTGCTGCACTACCCCGGCAGCGGCCTGCAGGCCGTGG
TGGATGACCTGGCAATGGCGGCCGCAGATGCACGCGGCGACGCCGCCCCGGCGGCCGTGG
CGGCGCTCCGGGCGCTGGCAGGTGCGGTGGGCCGTGTGGCGACACTGCCCGCTGCCGACA
TTTCCCGTGACAAGGCCGCAGCCGTGGCGGTATGCCTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000152A_C01 KCC000152A_c01
         (818 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|EAA39492.1| GLP_26_54603_52153 [Giardia lamblia ATCC 50803]         59  1e-07
ref|XP_233556.2| similar to Ser/Arg-related nuclear matrix prote...    58  2e-07
ref|ZP_00140133.1| COG1108: ABC-type Mn2+/Zn2+ transport systems...    57  3e-07
gb|AAK53449.1| unknown [Streptomyces aureofaciens]                     56  8e-07
ref|NP_058079.1| Ser/Arg-related nuclear matrix protein; plenty-...    55  1e-06

>gb|EAA39492.1| GLP_26_54603_52153 [Giardia lamblia ATCC 50803]
          Length = 816

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 69/198 (34%), Positives = 79/198 (39%), Gaps = 42/198 (21%)
 Frame = -3

Query: 804 RLRPCHGKCRQRAVSPHGP---PHLPAPGAPPRPPGRRRR-VHLRPP---LPGH---PPR 655
           R R C G  R R  +P GP   P  P P A P PP   R  V  R P   L G    PPR
Sbjct: 348 RRRVCRGPPRGRGGAPRGPARLPRAPPPAARPGPPPPGRALVRARAPAARLRGARRGPPR 407

Query: 654 PAGRCRGSAAGRRWRSLTARRRPRQRRPQTSWPAAGPPGTAAAPTQ------GP------ 511
            A R R  A  R  R L A RR R   P+      GPPG  A P +      GP      
Sbjct: 408 GALRRRPRARPRVPRVLRAPRRDRPVAPRPRPVRRGPPGAEARPGRRRGRRGGPPTSGLA 467

Query: 510 ---SASPRPRPSRR-----------HSRRCRMHSLAGAGAAGQGGRWPARG---RAGAGA 382
              S +P PR +RR            SR  +  ++A AGA     R   R    R  +G+
Sbjct: 468 FTQSGAPDPRAARRPATSPRSRATSSSRALKRRAVATAGAPPSASRSSTRAAAVRRRSGS 527

Query: 381 ARRRCTR-PRP--QPDAP 337
             RR  R PR    P AP
Sbjct: 528 RTRRWARTPRTTGSPTAP 545

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 61/182 (33%), Positives = 67/182 (36%), Gaps = 25/182 (13%)
 Frame = -3

Query: 804 RLRPCHGKCRQ-----RAVSPHGPPHLPA----PGAPPRPPGRRRRVHLRPP------LP 670
           RL P    CR+     R      P  +P     P  P  PP  R RV   P        P
Sbjct: 154 RLGPRAPVCRRPRRAGRGAPGRAPGRVPVRRRVPARPAPPPAARYRVRALPERGAPRGAP 213

Query: 669 GHPPRPAGRCRGSAAGRRWRSLT---ARRRPRQRRPQTSWPAA-------GPPGTAAAPT 520
           G    P  R RG  A  R R L    AR  PR  R +    AA       GPP  AAAP 
Sbjct: 214 GRHGPPGLRPRGRGACARRRPLPVPRARGPPRGVRARLGRDAARRGVAARGPPARAAAPG 273

Query: 519 QGPSASPRPRPSRRHSRRCRMHSLAGAGAAGQGGRWPARGRAGAGAARRRCTRPRPQPDA 340
           +      RP P  R     R     G  +   G R P RG A  G   R   RPRP+  A
Sbjct: 274 RAGDRRGRPGPRPRVRAPLRPRHADGRLSPPPGRRGPPRGDARRGPPPRP-RRPRPRRRA 332

Query: 339 PL 334
           PL
Sbjct: 333 PL 334

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 62/202 (30%), Positives = 69/202 (33%), Gaps = 45/202 (22%)
 Frame = -3

Query: 810 PPRLRPCHGKCRQRAVSPHGPPHLP-APGAPPRPPGRRRRVHLRPPLPGHPPRPAGRCRG 634
           P R R C  + R  A  P  P     AP   P PPG  RR    P   G     AGR  G
Sbjct: 3   PARARLCDVRRRPGAPRPGRPRGAQRAPRPAPDPPGPGRRPPRAPGALGGMLPAAGRLAG 62

Query: 633 SAAGRRWRSLTAR--------------------------------RRPRQRRPQTSWPAA 550
            A GR  R+ +                                   RPRQR P  +  A 
Sbjct: 63  PARGRGLRAASGALRGVRPVLRPRGRPVARPGRVGRGGGLGRLRDGRPRQRAPGRALGAP 122

Query: 549 G---PPGTAAAPTQGPSASPRPRPSRR--------HSRRCRMHSLAGAGAAGQG-GRWPA 406
           G   PP    AP +G     RPR  RR         +  CR    AG GA G+  GR P 
Sbjct: 123 GRRRPPAGRRAPVRGDRRRGRPRAPRRGPGGRLGPRAPVCRRPRRAGRGAPGRAPGRVPV 182

Query: 405 RGRAGAGAARRRCTRPRPQPDA 340
           R R  A        RP P P A
Sbjct: 183 RRRVPA--------RPAPPPAA 196

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 64/161 (39%), Positives = 67/161 (40%), Gaps = 19/161 (11%)
 Frame = +2

Query: 329 RWSGASGCGRGRVQRRLAAPAPALPLAGQRPP-CPAA-----PAPARLCIRQRREWRRLG 490
           R  GA   GR R  +R   PAP  P  G+RPP  P A     PA  RL    R      G
Sbjct: 13  RRPGAPRPGRPRGAQRAPRPAPDPPGPGRRPPRAPGALGGMLPAAGRLAGPAR------G 66

Query: 491 RGRGLADGPCVGAAAV---PGGPAAGQEV*GR-R*RGRRRAVRLRQRLP-----AALPRQ 643
           RG   A G   G   V    G P A     GR    GR R  R RQR P     A   R+
Sbjct: 67  RGLRAASGALRGVRPVLRPRGRPVARPGRVGRGGGLGRLRDGRPRQRAPGRALGAPGRRR 126

Query: 644 RPAGRGG*PGNGGRRCTR----RRRPGGRGGAPGAGRCGGP 754
            PAGR   P  G RR  R    RR PGGR G P A  C  P
Sbjct: 127 PPAGRRA-PVRGDRRRGRPRAPRRGPGGRLG-PRAPVCRRP 165

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 53/168 (31%), Positives = 62/168 (36%), Gaps = 10/168 (5%)
 Frame = -3

Query: 810 PPRLRPCHGKCRQRAVSPHGPPHLPAPGAPPR-------PPGRRR--RVHLRPPLPGHPP 658
           PP      G+   R   P   P + AP  P         PPGRR   R   R   P  P 
Sbjct: 265 PPARAAAPGRAGDRRGRPGPRPRVRAPLRPRHADGRLSPPPGRRGPPRGDARRGPPPRPR 324

Query: 657 RPAGRCRGSAAGRRWRSLTARRRPRQRRPQTSWPAAGPPGTAAAPTQGPSASPR-PRPSR 481
           RP  R R      R  +  ARRR R+          GPP       +GP+  PR P P+ 
Sbjct: 325 RPRPRRRAPLRSARRGAPDARRRRRR-------VCRGPPRGRGGAPRGPARLPRAPPPAA 377

Query: 480 RHSRRCRMHSLAGAGAAGQGGRWPARGRAGAGAARRRCTRPRPQPDAP 337
           R        +L  A A     R   RG    GA RR   RPR +P  P
Sbjct: 378 RPGPPPPGRALVRARAPAARLRGARRG-PPRGALRR---RPRARPRVP 421

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 48/171 (28%), Positives = 63/171 (36%), Gaps = 18/171 (10%)
 Frame = -3

Query: 807 PRLRP-----CHGKCRQRAVSPHGPPHLPAPGAPPRPPGRRRRVHLRPPLPGHPPRPAG- 646
           PR RP          R R V+P   P    P      PGRRR     PP  G     +G 
Sbjct: 414 PRARPRVPRVLRAPRRDRPVAPRPRPVRRGPPGAEARPGRRRGRRGGPPTSGLAFTQSGA 473

Query: 645 ----RCRGSAAGRRWRSLTARRRPRQRRPQTSWPAAGPPGTAAAPTQGPSASPRPRPSRR 478
                 R  A   R R+ ++ R  ++R   T   A  PP  + + T+  +A+ R R   R
Sbjct: 474 PDPRAARRPATSPRSRATSSSRALKRRAVAT---AGAPPSASRSSTR--AAAVRRRSGSR 528

Query: 477 HSRRCRMHSLAGAGAAGQGGRWPAR--------GRAGAGAARRRCTRPRPQ 349
             R  R     G+  A + GR PA         G     AARR      P+
Sbjct: 529 TRRWARTPRTTGSPTAPRSGRQPANVDLRGGPPGEERGPAARRELVGDHPE 579

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 62/178 (34%), Positives = 71/178 (39%), Gaps = 19/178 (10%)
 Frame = +2

Query: 278 RATEALRCRVHHDEQPTRWSGASGCGRGRVQRRLAAPAPALPLAGQRPPCPAAPAPARLC 457
           R    LR R H D + +   G  G  RG   RR   P P  P   +R P  +A   A   
Sbjct: 287 RVRAPLRPR-HADGRLSPPPGRRGPPRGDA-RRGPPPRPRRPRPRRRAPLRSARRGAPDA 344

Query: 458 IRQRRE-WRRLGRGRGLAD-GPC-----VGAAAVPGGPAAGQEV*-----GRR*RGRRR- 598
            R+RR   R   RGRG A  GP         AA PG P  G+ +        R RG RR 
Sbjct: 345 RRRRRRVCRGPPRGRGGAPRGPARLPRAPPPAARPGPPPPGRALVRARAPAARLRGARRG 404

Query: 599 ----AVRLRQRLPAALPRQRPAGRGG*PGNGGRRCTRRRRPGGRGGAPG--AGRCGGP 754
               A+R R R    +PR   A R   P     R  RR  PG     PG   GR GGP
Sbjct: 405 PPRGALRRRPRARPRVPRVLRAPRRDRPVAPRPRPVRRGPPGAE-ARPGRRRGRRGGP 461

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 47/133 (35%), Positives = 53/133 (39%), Gaps = 3/133 (2%)
 Frame = +2

Query: 341 ASGCGRGRVQRRLAAPAPALPLAGQRPPCPAAPAPARLCIRQRREWRRLGRGRGLADGPC 520
           A G  RG V+ RL   A    +A + PP  AA AP R   R+ R   R      L     
Sbjct: 240 ARGPPRG-VRARLGRDAARRGVAARGPPARAA-APGRAGDRRGRPGPRPRVRAPLRPRHA 297

Query: 521 VGAAAVPGG---PAAGQEV*GRR*RGRRRAVRLRQRLPAALPRQRPAGRGG*PGNGGRRC 691
            G  + P G   P  G    G   R RR   R R+R P      R A RG       RR 
Sbjct: 298 DGRLSPPPGRRGPPRGDARRGPPPRPRRP--RPRRRAPL-----RSARRGAPDARRRRRR 350

Query: 692 TRRRRPGGRGGAP 730
             R  P GRGGAP
Sbjct: 351 VCRGPPRGRGGAP 363

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 76/235 (32%), Positives = 80/235 (33%), Gaps = 48/235 (20%)
 Frame = +2

Query: 218 RLAG---SHGCRETSGIPSCWTDRATEALRCRVHHDEQPTRWSGASGCGR---GRVQRR- 376
           RLAG     G R  SG            LR R     +P R     G GR   GR ++R 
Sbjct: 59  RLAGPARGRGLRAASGA----LRGVRPVLRPRGRPVARPGRVGRGGGLGRLRDGRPRQRA 114

Query: 377 ----LAAPAPALPLAGQRPPC--------PAAP---APARLCIRQR--REWRRLGRGR-G 502
               L AP    P AG+R P         P AP      RL  R    R  RR GRG  G
Sbjct: 115 PGRALGAPGRRRPPAGRRAPVRGDRRRGRPRAPRRGPGGRLGPRAPVCRRPRRAGRGAPG 174

Query: 503 LADGPCVGAAAVPG----GPAAGQEV*GRR*RGRRRAVRLRQRLPAALPRQR-------- 646
            A G       VP      PAA   V     RG  R    R   P   PR R        
Sbjct: 175 RAPGRVPVRRRVPARPAPPPAARYRVRALPERGAPRGAPGRHGPPGLRPRGRGACARRRP 234

Query: 647 -PAGRGG*PGNG-----GRRCTRR----RRPGGRGGAPG-AGRCGGPCGDTARCR 778
            P  R   P  G     GR   RR    R P  R  APG AG   G  G   R R
Sbjct: 235 LPVPRARGPPRGVRARLGRDAARRGVAARGPPARAAAPGRAGDRRGRPGPRPRVR 289

>ref|XP_233556.2| similar to Ser/Arg-related nuclear matrix protein;
            plenty-of-prolines-101; serine/arginine repetitive matrix
            protein 1 [Rattus norvegicus]
          Length = 958

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 49/155 (31%), Positives = 65/155 (41%), Gaps = 16/155 (10%)
 Frame = -3

Query: 750  PPHLPAPGAPPRPPGRRRRVHLRPPLPGHPPRPAGRC--------RGSAAGRRWRSLTAR 595
            PP  P   A P PP +RR  H  PP    PP    R         +GS+ GR  R   + 
Sbjct: 671  PPPPPKRRASPSPPPKRRVSHSPPPKQRSPPVTKRRSPSLSSKHRKGSSPGRSTREARSP 730

Query: 594  R-------RPRQRRPQTSWPAAGPPGTAAAPTQGPSASPRPRPSRRHSRRCRMHSL-AGA 439
            +        PR R PQTS P     G +A+P    S SP  RP RR SR      +   A
Sbjct: 731  QPNKRHSPSPRPRAPQTSSPPPVRRGASASPQGRQSPSPSTRPIRRVSRTPEPKKIKKAA 790

Query: 438  GAAGQGGRWPARGRAGAGAARRRCTRPRPQPDAPL 334
              + Q  R  +  R+ +G+      +P P P +P+
Sbjct: 791  SPSPQSVRRVSSSRSVSGSPEPTAKKP-PAPPSPV 824

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 55/171 (32%), Positives = 68/171 (39%), Gaps = 14/171 (8%)
 Frame = -3

Query: 807  PRLRPCHGKCRQRAVSPHGPP----HLPAPGAPPRPPG-RRRRVHLRPPLPGHPPRPAGR 643
            PR R      R+R  SP  PP      P+P  PP PP   RRR    PP     P P  R
Sbjct: 582  PRKRQKETSPRRRRRSPSPPPARRRRSPSPAPPPPPPPPPRRRRSPTPPPRRRTPSPPPR 641

Query: 642  CRGSAAGRRWRSLTARR----RPRQRRPQTSWPAAGPPGTAAAPTQGP----SASPRPRP 487
             R S + RR+     RR     P +RR  +  P   PP   A+P+  P    S SP P+ 
Sbjct: 642  -RRSPSPRRYSPPIQRRYSPSPPPKRRTASPPP---PPKRRASPSPPPKRRVSHSPPPKQ 697

Query: 486  SRRHSRRCRMHSLAGAGAAGQG-GRWPARGRAGAGAARRRCTRPRPQPDAP 337
                  + R  SL+     G   GR     R+     R     P P+P AP
Sbjct: 698  RSPPVTKRRSPSLSSKHRKGSSPGRSTREARSPQPNKRH---SPSPRPRAP 745

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 50/169 (29%), Positives = 62/169 (36%), Gaps = 15/169 (8%)
 Frame = -3

Query: 807 PRLRPCHGKCRQRAVSPHGPPHLPAPGAPPRPPGRRRR---------------VHLRPPL 673
           PR RP     R+R      PP  P      R PGRRRR                  R P 
Sbjct: 374 PRRRPSP---RRRTPPRRMPP--PPRHRRSRSPGRRRRRSSASLSGSSSSSSSSRSRSP- 427

Query: 672 PGHPPRPAGRCRGSAAGRRWRSLTARRRPRQRRPQTSWPAAGPPGTAAAPTQGPSASPRP 493
           P  PP+     R S+  R+ R L+    P +RR + S PA  PP T  +PT  P  S R 
Sbjct: 428 PKKPPK-----RTSSPPRKTRRLSPSASPPRRRHRPSSPATPPPKTRHSPT--PQQSNRA 480

Query: 492 RPSRRHSRRCRMHSLAGAGAAGQGGRWPARGRAGAGAARRRCTRPRPQP 346
           R SR                +   GR   +     G  +R    P P+P
Sbjct: 481 RKSR---------------VSVSPGRTSGKVTKHKGTEKRESPSPAPKP 514

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 36/129 (27%), Positives = 52/129 (39%), Gaps = 20/129 (15%)
 Frame = -2

Query: 808  ATAAALSREMSAAGSVATRPTAPASAR-------SAATAAGAASPRASAAAIARSSTT-- 656
            +T  A S + +   S + RP AP ++        ++A+  G  SP  S   I R S T  
Sbjct: 723  STREARSPQPNKRHSPSPRPRAPQTSSPPPVRRGASASPQGRQSPSPSTRPIRRVSRTPE 782

Query: 655  ------ACRPLPG*C-----SREALAKPDSTSAASSAPPSNFLACSWSSRHRSSADARPV 509
                  A  P P        SR     P+ T+    APPS   + S S+    +A A+  
Sbjct: 783  PKKIKKAASPSPQSVRRVSSSRSVSGSPEPTAKKPPAPPSPVQSQSPSTNWSPAAPAKKA 842

Query: 508  GEPAPAPEP 482
              P P+P P
Sbjct: 843  KSPTPSPSP 851

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 29/88 (32%), Positives = 35/88 (38%), Gaps = 2/88 (2%)
 Frame = -3

Query: 708 GRRRRVHLRPPLPGHPPRPAGRCRGSAAGRRWRSLTA--RRRPRQRRPQTSWPAAGPPGT 535
           GRRRR     P     P P  R + ++  RR RS +    RR R   P    P   PP  
Sbjct: 567 GRRRR---HSPSRSASPSPRKRQKETSPRRRRRSPSPPPARRRRSPSPAPPPPPPPPPRR 623

Query: 534 AAAPTQGPSASPRPRPSRRHSRRCRMHS 451
             +PT  P       P RR S   R +S
Sbjct: 624 RRSPTPPPRRRTPSPPPRRRSPSPRRYS 651

 Score = 32.7 bits (73), Expect = 7.3
 Identities = 30/91 (32%), Positives = 40/91 (42%), Gaps = 7/91 (7%)
 Frame = +1

Query: 373 ASGRASPCPSPRWPAPPLP----SSTSTSKTMHPAAPRVAAARARARARRR---ALRRRC 531
           A  R SP P+P  P PP P    S T   +   P+ P     R R+ + RR    ++RR 
Sbjct: 603 ARRRRSPSPAPPPPPPPPPRRRRSPTPPPRRRTPSPP----PRRRSPSPRRYSPPIQRR- 657

Query: 532 CGAWRTSCRPRSLRAALTRPPTCCQASPAPP 624
                +   P   R A   PP   +ASP+PP
Sbjct: 658 ----YSPSPPPKRRTASPPPPPKRRASPSPP 684

>ref|ZP_00140133.1| COG1108: ABC-type Mn2+/Zn2+ transport systems, permease components
           [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 478

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 56/152 (36%), Positives = 62/152 (39%), Gaps = 17/152 (11%)
 Frame = -3

Query: 729 GAPPRPPGRRRRVHLRP-PLPGHPPRPA-----GRCRGSAAGRR-WRSLTARRRPRQRRP 571
           G  PRP   RRR H R  P P   PRP      G  RG  AGR   ++ +A  RP +RR 
Sbjct: 16  GVRPRPAAHRRRFHGRHVPAPSGLPRPVAQPAPGDRRGPGAGRHAGQARSAHGRPLRRRA 75

Query: 570 QTSWPAAGP-PGTAAAPTQGPSASPRPRPSRRHSRRCRMHSLA------GAGAAGQGGRW 412
                AAGP PGTAAA          PR  R    R     LA          A  GGR 
Sbjct: 76  PAR--AAGPGPGTAAATAGAGRTDVGPRRGRHPGLRAAAAGLAPGRRHRALDRARPGGRR 133

Query: 411 PAR---GRAGAGAARRRCTRPRPQPDAPLHRV 325
           P R    R+    A RR    +P P  P H V
Sbjct: 134 PPRRPGQRSQPPPAVRRSGGQQPDPGTPAHAV 165

>gb|AAK53449.1| unknown [Streptomyces aureofaciens]
          Length = 579

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 61/195 (31%), Positives = 68/195 (34%), Gaps = 8/195 (4%)
 Frame = -3

Query: 780 CRQRAVSPHGPPHLPAPGAPPRPPGRRRRVHLRPPLPGHP-PRPAGRCRGSAAGRRWRSL 604
           CR   V P GP +    G P    G  R  H RPP    P PRPA     S   R     
Sbjct: 372 CRGAGVEPEGPANGAGAGRPTATSGYARPQHARPPARAPPGPRPAPTRAASTPAR----T 427

Query: 603 TARRRPRQRRPQTSWPA-AGPPGTAAAPTQGPSASPRPRPSRRHSRRCRMHSLAGAGAAG 427
            +R      RP    PA A PP  AAAPT      P P P    +RR      AG G   
Sbjct: 428 GSRPASPPTRPTAPSPAPAAPPRAAAAPTPARRPPPPPTPPVPRARR---GPAAGNGRPP 484

Query: 426 Q------GGRWPARGRAGAGAARRRCTRPRPQPDAPLHRVGCSSW*TRHRSASVALSVQH 265
                  G R PA         RRR  RP P    P H         R+ SA      + 
Sbjct: 485 STRDRTAGTRAPASPPGAPPPVRRR--RPPPPRAPPPHHPS-----ARNPSARATPRPRP 537

Query: 264 EGMPLVSRQPCEPAR 220
              P  + +P  P R
Sbjct: 538 PPRPSAAARPEPPPR 552

 Score = 52.4 bits (124), Expect = 9e-06
 Identities = 48/128 (37%), Positives = 55/128 (42%), Gaps = 1/128 (0%)
 Frame = -3

Query: 717 RPPGRRRRVHLRPPLPGHPPRPAGRCRGSAAGR-RWRSLTARRRPRQRRPQTSWPAAGPP 541
           R PG+R RV       GH  + AG+  G  A R R R+    +R R R P T+ P  GP 
Sbjct: 291 RLPGQRERV-------GHVQQRAGQQEGPPAERHRARADDPAQRRRGRPPATTGPRTGPA 343

Query: 540 GTAAAPTQGPSASPRPRPSRRHSRRCRMHSLAGAGAAGQGGRWPARGRAGAGAARRRCTR 361
           G A       SA  R R  R    RCR     GAG   +G   PA G AGAG        
Sbjct: 344 GPAGPAGPRRSAPGRARRIRARGSRCR--CCRGAGVEPEG---PANG-AGAGRPTATSGY 397

Query: 360 PRPQPDAP 337
            RPQ   P
Sbjct: 398 ARPQHARP 405

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 54/163 (33%), Positives = 62/163 (37%), Gaps = 17/163 (10%)
 Frame = -3

Query: 810 PPRLRPCHGKCRQRAVSPHGPPHL--PAPGAPPRPPGRRRRVHLRPPLPGHPPRPAGRCR 637
           P R      +   R  SP   P    PAP APPR          RPP P  PP P  R R
Sbjct: 417 PTRAASTPARTGSRPASPPTRPTAPSPAPAAPPRAAAAPTPAR-RPPPPPTPPVPRAR-R 474

Query: 636 GSAAGR----RWRSLTARRR---------PRQRRPQTSWPAAGPPGTAAAPTQGPSASPR 496
           G AAG       R  TA  R         P  RR +   P A PP   +A      A+PR
Sbjct: 475 GPAAGNGRPPSTRDRTAGTRAPASPPGAPPPVRRRRPPPPRAPPPHHPSARNPSARATPR 534

Query: 495 PRPSRRHSRRCRMH--SLAGAGAAGQGGRWPARGRAGAGAARR 373
           PRP  R S   R      A  G +G     P+  R+ +   RR
Sbjct: 535 PRPPPRPSAAARPEPPPRAAPGPSGTAPGPPSGPRSPSPLHRR 577

 Score = 40.8 bits (94), Expect = 0.027
 Identities = 39/114 (34%), Positives = 40/114 (34%), Gaps = 6/114 (5%)
 Frame = -3

Query: 816 GIPPRLRPCHGKCRQRAVSPHGPPHL-----PAPGA-PPRPPGRRRRVHLRPPLPGHPPR 655
           G PP  R      R  A  P  PP +     P P A PP  P  R       P P  PPR
Sbjct: 481 GRPPSTRDRTAGTRAPASPPGAPPPVRRRRPPPPRAPPPHHPSARNPSARATPRPRPPPR 540

Query: 654 PAGRCRGSAAGRRWRSLTARRRPRQRRPQTSWPAAGPPGTAAAPTQGPSASPRP 493
           P              S  AR  P  R       A GP GTA  P  GP  SP P
Sbjct: 541 P--------------SAAARPEPPPR------AAPGPSGTAPGPPSGP-RSPSP 573

 Score = 37.0 bits (84), Expect = 0.39
 Identities = 38/117 (32%), Positives = 51/117 (43%), Gaps = 5/117 (4%)
 Frame = -2

Query: 796 ALSREMSAAGSVATRPTAPASARSAATAAGAASPRASAAAIARSSTTACRPLPG*CSREA 617
           A +R  S      +RP +P +  +A + A AA PRA+AA      T A RP P       
Sbjct: 416 APTRAASTPARTGSRPASPPTRPTAPSPAPAAPPRAAAA-----PTPARRPPPPPTPPVP 470

Query: 616 LAKPDSTSAASSAPPSNFLACSWSSRHRSS---ADARPVGEPAPA--PEPPPLAALP 461
            A+    +A +  PP        S+R R++   A A P G P P     PPP  A P
Sbjct: 471 RAR-RGPAAGNGRPP--------STRDRTAGTRAPASPPGAPPPVRRRRPPPPRAPP 518

 Score = 36.2 bits (82), Expect = 0.66
 Identities = 29/85 (34%), Positives = 34/85 (39%), Gaps = 8/85 (9%)
 Frame = -3

Query: 816 GIPPRLRPCHGKCRQRAVSPHGPP-HLPAPGAP-------PRPPGRRRRVHLRPPLPGHP 661
           G PP +R      R+R   P  PP H P+   P       PRPP R        P P   
Sbjct: 501 GAPPPVR------RRRPPPPRAPPPHHPSARNPSARATPRPRPPPRPSAAARPEPPPRAA 554

Query: 660 PRPAGRCRGSAAGRRWRSLTARRRP 586
           P P+G   G  +G R  S   RR P
Sbjct: 555 PGPSGTAPGPPSGPRSPSPLHRRTP 579

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 47/164 (28%), Positives = 53/164 (31%), Gaps = 16/164 (9%)
 Frame = +1

Query: 361 PCATASGRASPCPSPRWPAPPLPSSTSTSKT--MHPAAPRVAAARARARARRRALRRRCC 534
           P      RA      R   PP  +   T       PA PR +A     R R R  R RCC
Sbjct: 313 PAERHRARADDPAQRRRGRPPATTGPRTGPAGPAGPAGPRRSAPGRARRIRARGSRCRCC 372

Query: 535 --------------GAWRTSCRPRSLRAALTRPPTCCQASPAPPCCTTPAAACRPWWMTW 672
                         GA R +      R    RPP   +A P P    T AA+        
Sbjct: 373 RGAGVEPEGPANGAGAGRPTATSGYARPQHARPP--ARAPPGPRPAPTRAASTPA----- 425

Query: 673 QWRPQMHAATPPRRPWRRSGRWQVRWAVWRHCPLPTFPVTRPQP 804
             R     A+PP RP   S       A  R    PT P  RP P
Sbjct: 426 --RTGSRPASPPTRPTAPS---PAPAAPPRAAAAPT-PARRPPP 463

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 33/122 (27%), Positives = 41/122 (33%), Gaps = 1/122 (0%)
 Frame = +1

Query: 355 PRPCATASGRASPCPSPRWPAPPLPSSTSTSKTMHPAAPRVAAARARARARRRALRRRCC 534
           P P   A  RA+  P+P    PP P+         P  PR     A    R  + R R  
Sbjct: 441 PSPAPAAPPRAAAAPTPARRPPPPPT---------PPVPRARRGPAAGNGRPPSTRDRTA 491

Query: 535 GAWRTSCRPRS-LRAALTRPPTCCQASPAPPCCTTPAAACRPWWMTWQWRPQMHAATPPR 711
           G    +  P +       RPP      P  P    P+A   P       RP+     PP 
Sbjct: 492 GTRAPASPPGAPPPVRRRRPPPPRAPPPHHPSARNPSARATP-------RPR-----PPP 539

Query: 712 RP 717
           RP
Sbjct: 540 RP 541

>ref|NP_058079.1| Ser/Arg-related nuclear matrix protein; plenty-of-prolines-101;
            serine/arginine repetitive matrix protein 1 [Mus
            musculus] gi|3153821|gb|AAC17422.1|
            plenty-of-prolines-101; POP101; SH3-philo-protein [Mus
            musculus]
          Length = 897

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 48/155 (30%), Positives = 64/155 (40%), Gaps = 16/155 (10%)
 Frame = -3

Query: 750  PPHLPAPGAPPRPPGRRRRVHLRPPLPGHPPRPAGRC--------RGSAAGRRWRSLTAR 595
            PP  P   A P PP +RR  H  PP    P     R         +GS+ GR  R   + 
Sbjct: 636  PPPPPKRRASPSPPPKRRVSHSPPPKQRSPTVTKRRSPSLSSKHRKGSSPGRSTREARSP 695

Query: 594  R-------RPRQRRPQTSWPAAGPPGTAAAPTQGPSASPRPRPSRRHSRRCRMHSL-AGA 439
            +        PR R PQTS P     G +A+P    S SP  RP RR SR      +   A
Sbjct: 696  QPNKRHSPSPRPRAPQTSSPPPVRRGASASPQGRQSPSPSTRPIRRVSRTPEPKKIKKAA 755

Query: 438  GAAGQGGRWPARGRAGAGAARRRCTRPRPQPDAPL 334
              + Q  R  +  R+ +G+      +P P P +P+
Sbjct: 756  SPSPQSVRRVSSSRSVSGSPEPAAKKP-PAPPSPV 789

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 49/155 (31%), Positives = 59/155 (37%), Gaps = 8/155 (5%)
 Frame = -3

Query: 783 KCRQRAVSPHGPPHL------PAPGAPPRPPGRRRRVHLRPPLPGHPPRPAGRCRGSAAG 622
           K  +R  SP  PP        PAP  PP PP  RRR    PP     P P  R R S + 
Sbjct: 554 KSSRRRRSPSPPPARRRRSPSPAPPPPPPPPPPRRRRSPTPPPRRRTPSPPPR-RRSPSP 612

Query: 621 RRWRSLTARRRPRQRRPQTSWPAAGPPGTAAAPTQGPS--ASPRPRPSRRHSRRCRMHSL 448
           RR+        P QRR   S P   P    A+P   P   ASP P P RR S        
Sbjct: 613 RRYSP------PIQRRYSPSPP---PKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKQR 663

Query: 447 AGAGAAGQGGRWPARGRAGAGAARRRCTRPRPQPD 343
           +      +     ++ R G+   R       PQP+
Sbjct: 664 SPTVTKRRSPSLSSKHRKGSSPGRSTREARSPQPN 698

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 50/169 (29%), Positives = 62/169 (36%), Gaps = 15/169 (8%)
 Frame = -3

Query: 807 PRLRPCHGKCRQRAVSPHGPPHLPAPGAPPRPPGRRRR---------------VHLRPPL 673
           PR RP     R+R      PP  P      R PGRRRR                  R P 
Sbjct: 315 PRRRPSP---RRRTPPRRMPP--PPRHRRSRSPGRRRRRSSASLSGSSSSSSSSRSRSP- 368

Query: 672 PGHPPRPAGRCRGSAAGRRWRSLTARRRPRQRRPQTSWPAAGPPGTAAAPTQGPSASPRP 493
           P  PP+     R S+  R+ R L+    P +RR + S PA  PP T  +PT  P  S R 
Sbjct: 369 PKKPPK-----RTSSPPRKTRRLSPSASPPRRRHRPSSPATPPPKTRHSPT--PQQSNRT 421

Query: 492 RPSRRHSRRCRMHSLAGAGAAGQGGRWPARGRAGAGAARRRCTRPRPQP 346
           R SR                +   GR   +     G  +R    P P+P
Sbjct: 422 RKSR---------------VSVSPGRTSGKVTKHKGTEKRESPSPAPKP 455

 Score = 41.2 bits (95), Expect = 0.020
 Identities = 50/202 (24%), Positives = 71/202 (34%), Gaps = 18/202 (8%)
 Frame = -3

Query: 774  QRAVSPHGPPHLPAPGAPPR----------PPGRRRRVHLRPPL--PGHPPRPAGRCRGS 631
            +R  SP  PP    P  PPR          PP +RR     PP      PP P  R R S
Sbjct: 587  RRRRSPTPPPRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKR-RAS 645

Query: 630  AAGRRWRSLTARRRPRQRRPQTSWPAAGPPGTAAAPTQGPSASPR----PRPSRRH--SR 469
             +    R ++    P+QR P  +   +    +       P  S R    P+P++RH  S 
Sbjct: 646  PSPPPKRRVSHSPPPKQRSPTVTKRRSPSLSSKHRKGSSPGRSTREARSPQPNKRHSPSP 705

Query: 468  RCRMHSLAGAGAAGQGGRWPARGRAGAGAARRRCTRPRPQPDAPLHRVGCSSW*TRHRSA 289
            R R    +      +G     +GR     + R   R    P+    +   S      R  
Sbjct: 706  RPRAPQTSSPPPVRRGASASPQGRQSPSPSTRPIRRVSRTPEPKKIKKAASPSPQSVRRV 765

Query: 288  SVALSVQHEGMPLVSRQPCEPA 223
            S + SV     P   + P  P+
Sbjct: 766  SSSRSVSGSPEPAAKKPPAPPS 787

 Score = 35.8 bits (81), Expect = 0.86
 Identities = 34/104 (32%), Positives = 47/104 (44%), Gaps = 18/104 (17%)
 Frame = -3

Query: 708 GRRRRVHLRPPLPGHPPRPAGRCRGSAA----GRRWRS---LTARRR-----PRQRRPQT 565
           GRRRR+    P     P P  R + ++     G+RW+S    ++RRR     P  RR ++
Sbjct: 516 GRRRRLS---PSRSASPSPRKRQKETSPRMQMGKRWQSPVTKSSRRRRSPSPPPARRRRS 572

Query: 564 SWPAAGPPGTAAAPTQGPSASPRPR------PSRRHSRRCRMHS 451
             PA  PP     P +  S +P PR      P RR S   R +S
Sbjct: 573 PSPAPPPPPPPPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYS 616

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 45/181 (24%), Positives = 63/181 (33%), Gaps = 1/181 (0%)
 Frame = -3

Query: 747 PHLPAPGAPPRPPGRRRRVHLRPPLPGHPPRPAGRCRGSAAGRRWRSLTARRRPRQRRPQ 568
           P LP P    +    +        L    P P    +  +  +  +    + RPR R   
Sbjct: 221 PELPEPSVRMKDSSVQEATSTSDILKAPKPEPVPEPKEPSPEKNSKKEKEKTRPRSRSRS 280

Query: 567 TSWPAAGPPGTAAAPTQGPSASPRPRPSRRHSRRCRMHSLAGAGAAGQGGRWPARGRAGA 388
            S         +   ++ PS +   RP RRH  R R +S           R P+  R   
Sbjct: 281 KS--------RSRTRSRSPSHT---RPRRRHRSRSRSYSPR---------RRPSPRRR-- 318

Query: 387 GAARRRCTRPRPQPDAPLHRVGCSSW*TRHR-SASVALSVQHEGMPLVSRQPCEPARRGG 211
             + RR T PR  P  P HR   S    R R SAS++ S            P +P +R  
Sbjct: 319 -PSPRRRTPPRRMPPPPRHRRSRSPGRRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTS 377

Query: 210 S 208
           S
Sbjct: 378 S 378

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 29/88 (32%), Positives = 36/88 (39%), Gaps = 4/88 (4%)
 Frame = +1

Query: 373 ASGRASPCPSPRWPAPPLPSSTSTSKTMHP--AAPRVAAARARARARRRA--LRRRCCGA 540
           A  R SP P+P  P PP P     S T  P    P     R     RR +  ++RR    
Sbjct: 567 ARRRRSPSPAPPPPPPPPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSPPIQRR---- 622

Query: 541 WRTSCRPRSLRAALTRPPTCCQASPAPP 624
             +   P   R A   PP   +ASP+PP
Sbjct: 623 -YSPSPPPKRRTASPPPPPKRRASPSPP 649



EST assemble image


clone accession position
1 MXL075b11_r BP097407 1 378
2 HCL048b06_r AV642240 17 238
3 CL07b12_r AV393465 43 307
4 CL65a03_r AV396582 45 360
5 HCL045f04_r AV642098 45 333
6 MXL004e07_r BP093170 45 339
7 HCL039h12_r AV641769 45 521
8 HCL088h06_r AV644456 45 369
9 LCL053e06_r AV629167 322 820
10 HCL022e03_r AV640790 329 698




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research