KCC000050A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000050A_C01 KCC000050A_c01
CTTCGAGGAGCGTAGAGAAATGGCCCCGAAAGGCAAGGCTGACGCCAAGGCGGTGGCCGC
CAAGGCTGCTAAGGCTGTGAAGAAGGGTAGCTTCAAGAAGAGCCGGAAGCCCCGGTTCTC
GGTGGTCTTCCACCGCCCGAAGACCCTGCAGCGCACCCGCGAGGGCAAGTACCCGAAGAT
CAGCACGCCCTCGCTTCAAAAGCTTGACCAGTACGCGGTGCTCAAGTTCCCCCTGACCAC
CGAGTCGGCGATGAAGAAGATCGAGGACAACAACACCCTGGTCTTCATTGTTGACCTGAA
GGCCAGCAAGAAGCAGATCAAGGACGCCGTGTCGCGCATGTACGACGTGCAGACCAAGAA
GGTCAACACCCTCATCCGCCCCGACGGCCAGAAGAAGGCGTACGTCTGCCTCACCGCGGA
CTACGACGCCCTGGACGTTGCCAACAAGATTGGCATCATCTAAACGACTCGTCTCGAAGG
GACTGGGGAGCAGGAGGCGAAAGAGTGCGCTGTAACGCTGAAAGTCGTACATGCGCGACA
CGGCGTCCTTGATCTGCTTCTTGCTGGCCTTCAGGTCAACAATGAAGACCAGGGTGTTGT
TGTCCTCGATCTTCTTCATCGCCGACTCGGTGGTCAGGGGGAACTTGAGCACCGCGTACT
GGTCAAGCTTTTGAAGCGAGGGCGTGCTGATCTTCGGGTACTTGCCCTCGCGGGTGCCGG
AGGCGGGGGCGGAGGAACAGGGGGACGCGCGCGGCCCAAGCGGTCGGTCGGCGACT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000050A_C01 KCC000050A_c01
         (776 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAC09501.1| putative 60s Ribosomal protein L25 [Oryza sativa...   214  1e-54
emb|CAE01636.1| OSJNBa0029H02.21 [Oryza sativa (japonica cultiva...   214  1e-54
sp|Q07761|RL2B_TOBAC 60S RIBOSOMAL PROTEIN L23A (L25) gi|1084424...   213  4e-54
dbj|BAB63895.1| putative 60S ribosomal protein L23A [Oryza sativ...   207  2e-52
gb|AAK30202.1|AF349961_1 ribosome protein L23a [Daucus carota]        206  4e-52

>emb|CAC09501.1| putative 60s Ribosomal protein L25 [Oryza sativa (indica
           cultivar-group)]
          Length = 152

 Score =  214 bits (545), Expect = 1e-54
 Identities = 110/147 (74%), Positives = 125/147 (84%), Gaps = 1/147 (0%)
 Frame = +2

Query: 23  APKGKADAKAVAAKAAKAVKKGSFKKS-RKPRFSVVFHRPKTLQRTREGKYPKISTPSLQ 199
           AP  K DAKA A KAAKAVK G+ KK+ +K R SV FHRPKTL+++R+ KYP++STP   
Sbjct: 6   APAKKGDAKAQALKAAKAVKSGTAKKTTKKIRTSVTFHRPKTLKKSRDPKYPRVSTPGRN 65

Query: 200 KLDQYAVLKFPLTTESAMKKIEDNNTLVFIVDLKASKKQIKDAVSRMYDVQTKKVNTLIR 379
           KLDQY +LK+PLTTESAMKKIEDNNTLVFIVDLKA KK+IK AV +MYD+Q KKVNTLIR
Sbjct: 66  KLDQYQILKYPLTTESAMKKIEDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKVNTLIR 125

Query: 380 PDGQKKAYVCLTADYDALDVANKIGII 460
           PDG+KKAYV LT DYDALDVANKIGII
Sbjct: 126 PDGKKKAYVKLTPDYDALDVANKIGII 152

 Score =  103 bits (258), Expect = 2e-21
 Identities = 49/66 (74%), Positives = 57/66 (86%)
 Frame = -2

Query: 715 TREGKYPKISTPSLQKLDQYAVLKFPLTTESAMKKIEDNNTLVFIVDLKASKKQIKDAVS 536
           +R+ KYP++STP   KLDQY +LK+PLTTESAMKKIEDNNTLVFIVDLKA KK+IK AV 
Sbjct: 51  SRDPKYPRVSTPGRNKLDQYQILKYPLTTESAMKKIEDNNTLVFIVDLKADKKKIKAAVK 110

Query: 535 RMYDFQ 518
           +MYD Q
Sbjct: 111 KMYDIQ 116

>emb|CAE01636.1| OSJNBa0029H02.21 [Oryza sativa (japonica cultivar-group)]
          Length = 192

 Score =  214 bits (545), Expect = 1e-54
 Identities = 110/147 (74%), Positives = 125/147 (84%), Gaps = 1/147 (0%)
 Frame = +2

Query: 23  APKGKADAKAVAAKAAKAVKKGSFKKS-RKPRFSVVFHRPKTLQRTREGKYPKISTPSLQ 199
           AP  K DAKA A KAAKAVK G+ KK+ +K R SV FHRPKTL+++R+ KYP++STP   
Sbjct: 46  APAKKGDAKAQALKAAKAVKSGTAKKTTKKIRTSVTFHRPKTLKKSRDPKYPRVSTPGRN 105

Query: 200 KLDQYAVLKFPLTTESAMKKIEDNNTLVFIVDLKASKKQIKDAVSRMYDVQTKKVNTLIR 379
           KLDQY +LK+PLTTESAMKKIEDNNTLVFIVDLKA KK+IK AV +MYD+Q KKVNTLIR
Sbjct: 106 KLDQYQILKYPLTTESAMKKIEDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKVNTLIR 165

Query: 380 PDGQKKAYVCLTADYDALDVANKIGII 460
           PDG+KKAYV LT DYDALDVANKIGII
Sbjct: 166 PDGKKKAYVKLTPDYDALDVANKIGII 192

 Score =  103 bits (258), Expect = 2e-21
 Identities = 49/66 (74%), Positives = 57/66 (86%)
 Frame = -2

Query: 715 TREGKYPKISTPSLQKLDQYAVLKFPLTTESAMKKIEDNNTLVFIVDLKASKKQIKDAVS 536
           +R+ KYP++STP   KLDQY +LK+PLTTESAMKKIEDNNTLVFIVDLKA KK+IK AV 
Sbjct: 91  SRDPKYPRVSTPGRNKLDQYQILKYPLTTESAMKKIEDNNTLVFIVDLKADKKKIKAAVK 150

Query: 535 RMYDFQ 518
           +MYD Q
Sbjct: 151 KMYDIQ 156

>sp|Q07761|RL2B_TOBAC 60S RIBOSOMAL PROTEIN L23A (L25) gi|1084424|pir||S48026 ribosomal
           protein L23a, cytosolic - common tobacco
           gi|310935|gb|AAA53296.1| 60S ribosomal protein L25
          Length = 154

 Score =  213 bits (541), Expect = 4e-54
 Identities = 110/147 (74%), Positives = 121/147 (81%), Gaps = 2/147 (1%)
 Frame = +2

Query: 26  PKGKADAKAVAAKAAKAVKKGSF--KKSRKPRFSVVFHRPKTLQRTREGKYPKISTPSLQ 199
           P  K+D KA AAK AKAVK GS   KKS+K R  V FHRPKTL++ R  KYP+IS P   
Sbjct: 8   PSKKSDPKAQAAKVAKAVKSGSTLKKKSQKIRTKVTFHRPKTLKKDRNPKYPRISAPGRN 67

Query: 200 KLDQYAVLKFPLTTESAMKKIEDNNTLVFIVDLKASKKQIKDAVSRMYDVQTKKVNTLIR 379
           KLDQY +LK+PLTTESAMKKIEDNNTLVFIVD+KA KK+IKDAV +MYD+QTKKVNTLIR
Sbjct: 68  KLDQYGILKYPLTTESAMKKIEDNNTLVFIVDIKADKKKIKDAVKKMYDIQTKKVNTLIR 127

Query: 380 PDGQKKAYVCLTADYDALDVANKIGII 460
           PDG KKAYV LT DYDALDVANKIGII
Sbjct: 128 PDGTKKAYVRLTPDYDALDVANKIGII 154

 Score =  103 bits (258), Expect = 2e-21
 Identities = 49/65 (75%), Positives = 55/65 (84%)
 Frame = -2

Query: 712 REGKYPKISTPSLQKLDQYAVLKFPLTTESAMKKIEDNNTLVFIVDLKASKKQIKDAVSR 533
           R  KYP+IS P   KLDQY +LK+PLTTESAMKKIEDNNTLVFIVD+KA KK+IKDAV +
Sbjct: 54  RNPKYPRISAPGRNKLDQYGILKYPLTTESAMKKIEDNNTLVFIVDIKADKKKIKDAVKK 113

Query: 532 MYDFQ 518
           MYD Q
Sbjct: 114 MYDIQ 118

>dbj|BAB63895.1| putative 60S ribosomal protein L23A [Oryza sativa (japonica
           cultivar-group)] gi|21104815|dbj|BAB93400.1| putative
           60S ribosomal protein L23A [Oryza sativa (japonica
           cultivar-group)]
          Length = 152

 Score =  207 bits (526), Expect = 2e-52
 Identities = 111/152 (73%), Positives = 123/152 (80%), Gaps = 5/152 (3%)
 Frame = +2

Query: 20  MAPKG---KADAKAVAA-KAAKAVKKGSFK-KSRKPRFSVVFHRPKTLQRTREGKYPKIS 184
           MAPK    KAD K   A K AKAVK GS K KS+K R SV FHRPKTL++ R+ KYP++S
Sbjct: 1   MAPKAAVKKADGKTQQALKVAKAVKSGSIKRKSKKIRTSVTFHRPKTLKKARDPKYPRVS 60

Query: 185 TPSLQKLDQYAVLKFPLTTESAMKKIEDNNTLVFIVDLKASKKQIKDAVSRMYDVQTKKV 364
            P   KLDQY +LK+PLTTESAMKKIEDNNTLVFIVDLKA KK+IK AV +MYD+Q KKV
Sbjct: 61  APGRNKLDQYQILKYPLTTESAMKKIEDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKV 120

Query: 365 NTLIRPDGQKKAYVCLTADYDALDVANKIGII 460
           NTLIRPDG+KKAYV LT DYDALDVANKIGII
Sbjct: 121 NTLIRPDGKKKAYVKLTPDYDALDVANKIGII 152

 Score =  101 bits (252), Expect = 1e-20
 Identities = 48/65 (73%), Positives = 55/65 (83%)
 Frame = -2

Query: 712 REGKYPKISTPSLQKLDQYAVLKFPLTTESAMKKIEDNNTLVFIVDLKASKKQIKDAVSR 533
           R+ KYP++S P   KLDQY +LK+PLTTESAMKKIEDNNTLVFIVDLKA KK+IK AV +
Sbjct: 52  RDPKYPRVSAPGRNKLDQYQILKYPLTTESAMKKIEDNNTLVFIVDLKADKKKIKAAVKK 111

Query: 532 MYDFQ 518
           MYD Q
Sbjct: 112 MYDIQ 116

>gb|AAK30202.1|AF349961_1 ribosome protein L23a [Daucus carota]
          Length = 154

 Score =  206 bits (523), Expect = 4e-52
 Identities = 106/144 (73%), Positives = 120/144 (82%), Gaps = 2/144 (1%)
 Frame = +2

Query: 35  KADAKAVAAKAAKAVKKGS--FKKSRKPRFSVVFHRPKTLQRTREGKYPKISTPSLQKLD 208
           K+DAKA A K AKAVK G+  FKK +K R SV FHRP+TL + R  KYP+IS     KLD
Sbjct: 11  KSDAKAQALKTAKAVKSGTTKFKKVKKIRTSVTFHRPRTLTKDRNPKYPRISATPRNKLD 70

Query: 209 QYAVLKFPLTTESAMKKIEDNNTLVFIVDLKASKKQIKDAVSRMYDVQTKKVNTLIRPDG 388
           QY +LK+PLTTESAMKKIEDNNTLVFIVD++A+KK+IKDAV +MYD+QTKKVNTLIRPDG
Sbjct: 71  QYQILKYPLTTESAMKKIEDNNTLVFIVDIRANKKKIKDAVKKMYDIQTKKVNTLIRPDG 130

Query: 389 QKKAYVCLTADYDALDVANKIGII 460
            KKAYV LT DYDALDVANKIGII
Sbjct: 131 TKKAYVRLTPDYDALDVANKIGII 154

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 47/65 (72%), Positives = 55/65 (84%)
 Frame = -2

Query: 712 REGKYPKISTPSLQKLDQYAVLKFPLTTESAMKKIEDNNTLVFIVDLKASKKQIKDAVSR 533
           R  KYP+IS     KLDQY +LK+PLTTESAMKKIEDNNTLVFIVD++A+KK+IKDAV +
Sbjct: 54  RNPKYPRISATPRNKLDQYQILKYPLTTESAMKKIEDNNTLVFIVDIRANKKKIKDAVKK 113

Query: 532 MYDFQ 518
           MYD Q
Sbjct: 114 MYDIQ 118



EST assemble image


clone accession position
1 CL54f04_r AV396139 1 659
2 CM069c11_r AV391178 1 638
3 CL21a08_r AV394396 12 699
4 CL68e10_r AV396934 25 710
5 CL33b01_r AV394963 31 716
6 CM021f11_r AV387926 39 703
7 CL55d10_r AV396016 50 500
8 CM048g04_r AV389142 88 451
9 MXL036f09_r BP095149 91 564
10 CL44b11_r AV395595 91 658
11 CL37d01_r AV395250 91 625
12 CL48f07_r AV395815 91 707
13 CL21g01_r AV394379 96 658
14 HCL036c01_r AV641556 97 704
15 CL03a11_r AV393406 98 610
16 CL06c10_r AV393651 98 714
17 LC012g04_r AV619759 100 760
18 MX225b09_r BP090524 102 503
19 CM093f09_r AV393003 104 706
20 CL29a01_r AV394660 105 542
21 CL03c03_r AV393433 105 425
22 CL18f05_r AV394058 105 648
23 HCL015c06_r AV640382 105 459
24 CL13g08_r AV393937 105 698
25 CL73a04_r AV396975 105 705
26 CL78f05_r AV397234 105 638
27 CL58g01_r AV396198 105 709
28 CL18c07_r AV394087 105 711
29 HCL025g09_r AV640988 105 652
30 CL38g06_r AV395317 105 711
31 CL25g02_r AV394539 107 667
32 CL28b08_r AV394818 107 676
33 CL04a10_r AV393388 107 709
34 CL50a10_r AV395760 110 658
35 HCL079e02_r AV643975 112 676
36 CL36h12_r AV395170 113 709
37 CL02d08_r AV397612 114 698
38 CL48b01_r AV395782 115 681
39 CL34f08_r AV394925 115 707
40 CL21c07_r AV394344 115 726
41 CL51g08_r AV395937 116 705
42 CL62e03_r AV396411 117 612
43 CL07d03_r AV393456 117 633
44 CL69c07_r AV396778 117 712
45 CL03a08_r AV393426 119 709
46 CL26a10_r AV394620 122 707
47 CL53e11_r AV395993 123 551
48 CL47e09_r AV395693 124 717
49 MX101c04_r BP088803 128 707
50 HC085b08_r AV638341 149 844
51 CL27d03_r AV394725 152 716
52 CL75e11_r AV397088 153 709
53 MX102c04_r BP088888 157 707
54 CL58g12_r AV396184 157 807
55 CM092e05_r AV392662 159 761
56 HC069c12_r AV637143 199 722
57 MX101g07_r BP088847 209 707
58 MX101b10_r BP088797 215 707
59 MX103c03_r BP088966 217 811
60 MX102b08_r BP088881 224 707
61 HCL043d02_r AV641977 229 688
62 MX101f07_r BP088836 234 707
63 MX102f10_r BP088919 241 806
64 MX102b09_r BP088882 244 707
65 CL07h09_r AV393441 247 709
66 MX102a06_r BP088867 248 707
67 HC039c01_r AV634881 266 709
68 CM037f01_r AV388834 326 733
69 LC092g07_r AV625450 496 709
70 LCL040g07_r AV628376 501 761
71 HCL017a02_r AV640476 529 954
72 MX101f05_r BP088834 607 722




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research