KCC000049A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000049A_C01 KCC000049A_c01
CCCAGAGCTCCCATAGCCTCGTAGAGGCTGTGTTCGTGAAGTCGCGAGCGTGTAAGAACG
AGTAGTACTTTGACGGGAAAGGACGCTGCAGCGCCTGCAGAGACCGCGCCGTCTCAACGA
GCTTAAAGAGGAATCTGATATTGCGTTGTCCTTCGAACATGTCAGCCATGACTGCCGTTG
CTGTCAACAACAAGAAGCGCTCGGCGGCCGAGGCTTGCGCCTCTGCTCCGGCTGCGAAGA
AGCCGGCTGCCGCGTCAACAGCAATTGCGGCCGGCGCTGCTGCGCCGCTGGCGATGGCAG
GTTGGACGTACCCACCTCTGCCGATGGGTATGATGCCGCCGATGCCGATGTGCATGCCGG
GAATGGGCATGTTCCCCCCGTTTATGGGCATGGGCATGTTCCCCCCGTTTTGGCTGCCGG
CCGCCGCGATGGCCGCAGCTGCTGCATCAGCGGCGGGGGCGAGTGTAGCGACGATGCCCG
CGATGGCGGGGGCATGCAGCCTGCCCCAGGCTGCGCAGGCCGCAGCGATGTGGCCCGCGA
TGATGGCGTCGTGCGCAGCGGCCGCGGCCGCCTCGATGCCCGCTGCGGCCCCAGCCATGA
ACATG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000049A_C01 KCC000049A_c01
         (605 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_346988.1| protein tyrosine phosphatase, receptor type, F ...    64  2e-09
dbj|BAA20466.1| insoluble protein [Pinctada fucata]                    57  2e-07
emb|CAA56558.1| pprB [Pseudomonas putida]                              54  1e-06
ref|NP_742363.1| alginate regulatory protein AlgP [Pseudomonas p...    52  7e-06
ref|ZP_00092324.1| COG0654: 2-polyprenyl-6-methoxyphenol hydroxy...    51  1e-05

>ref|XP_346988.1| protein tyrosine phosphatase, receptor type, F [Rattus norvegicus]
          Length = 197

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 59/146 (40%), Positives = 64/146 (43%), Gaps = 1/146 (0%)
 Frame = +3

Query: 162 SAMTAVAVNNKKRSAAEACASAPAAKKPAAASTAIAAGAAAPLAMAGWTYPPLPM-GMMP 338
           +A  A A       AA A A+A  A   AAA  A  AGAAA  A AG         G   
Sbjct: 38  AATGAAATTAAAAGAAAAAAAATTAAAAAAAGAAATAGAAAAAAAAGAAATAAAAAGAAA 97

Query: 339 PMPMCMPGMGMFPPFMGMGMFPPFWLPAAAMAAAAASAAGASVATMPAMAGACSLPQAAQ 518
                           G          AAA AAAAA+AAGA+ AT  A AGA S   AA 
Sbjct: 98  TAEAAAGAAAAAAAAAGAAEASEAAAGAAAAAAAAAAAAGAT-ATAAAAAGAASAAAAAA 156

Query: 519 AAAMWPAMMASCAAAAAASMPAAAPA 596
            AA  PA  A  AAAAAA+  AAA A
Sbjct: 157 GAAEAPAAAAGAAAAAAAAAAAAAAA 182

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 55/143 (38%), Positives = 58/143 (40%)
 Frame = -2

Query: 595 AGAAAGIEAAAAAAHDAIIAGHIAAACAAWGRLHAPAIAGIVATLAPAADAAAAAIAAAG 416
           A AAA   AAAAAA  A  AG  AAA AA     A A AG  AT   AA AAAAA AAAG
Sbjct: 55  AAAAATTAAAAAAAGAAATAGAAAAAAAAGAAATAAAAAGAAATAEAAAGAAAAAAAAAG 114

Query: 415 SQNGGNMPMPINGGNMPIPGMHIGIGGIIPIGRGGYVQPAIASGAAAPAAIAVDAAAGFF 236
           +                                      A A  A APAA A  AAA   
Sbjct: 115 AAEASEAAAGAAAAAAAAAAAAGATATAAAAAGAASAAAAAAGAAEAPAAAAGAAAAAAA 174

Query: 235 AAGAEAQASAAERFLLLTATAVM 167
           AA A A A+A        A+A M
Sbjct: 175 AAAAAAAAAATAAVPAGAASATM 197

 Score = 58.2 bits (139), Expect = 9e-08
 Identities = 56/145 (38%), Positives = 59/145 (40%), Gaps = 1/145 (0%)
 Frame = -2

Query: 595 AGAAAGIEAAAAAAHDAIIAGHIAAACAAWGRLHAPAIAGIVATLAPAADAAAAAIAAAG 416
           AGAAA    AAAAA  A  A   AAA A        A AG  A  A A  AAAAA A A 
Sbjct: 12  AGAAAPAGTAAAAAAAAAAAAAAAAAAATGAAATTAAAAGAAAAAAAATTAAAAAAAGAA 71

Query: 415 SQNGGNMPMPINGGNMPIPGMHIGIGGIIPIGRGGYVQPAIASGAAAPAAIAVDAA-AGF 239
           +  G                   G         G       A+GAAA AA A  AA A  
Sbjct: 72  ATAGA-----------AAAAAAAGAAATAAAAAGAAATAEAAAGAAAAAAAAAGAAEASE 120

Query: 238 FAAGAEAQASAAERFLLLTATAVMA 164
            AAGA A A+AA      TATA  A
Sbjct: 121 AAAGAAAAAAAAAAAAGATATAAAA 145

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 46/131 (35%), Positives = 53/131 (40%)
 Frame = +3

Query: 204 AAEACASAPAAKKPAAASTAIAAGAAAPLAMAGWTYPPLPMGMMPPMPMCMPGMGMFPPF 383
           A +A A A A    AAA+ A AA AAA  A A                            
Sbjct: 7   AVQAAAGAAAPAGTAAAAAAAAAAAAAAAAAAA--------------------------- 39

Query: 384 MGMGMFPPFWLPAAAMAAAAASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCAAA 563
            G          AAA AAAA +AA A+ A   A AGA +   AA AAA   A   + A A
Sbjct: 40  TGAAATTAAAAGAAAAAAAATTAAAAAAAGAAATAGAAAAAAAAGAAATAAAAAGAAATA 99

Query: 564 AAASMPAAAPA 596
            AA+  AAA A
Sbjct: 100 EAAAGAAAAAA 110

 Score = 45.1 bits (105), Expect = 8e-04
 Identities = 44/129 (34%), Positives = 51/129 (39%)
 Frame = +3

Query: 201 SAAEACASAPAAKKPAAASTAIAAGAAAPLAMAGWTYPPLPMGMMPPMPMCMPGMGMFPP 380
           +A  A  +  AA   AAA+ A AA AAA    A  T                        
Sbjct: 11  AAGAAAPAGTAAAAAAAAAAAAAAAAAAATGAAATTAAAAGAAAAAAAATTAAAAAAAGA 70

Query: 381 FMGMGMFPPFWLPAAAMAAAAASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCAA 560
               G        AAA AAA A+AA  + AT  A AGA +   AA  AA      A  AA
Sbjct: 71  AATAGAAA---AAAAAGAAATAAAAAGAAATAEAAAGAAAAAAAAAGAAEASEAAAGAAA 127

Query: 561 AAAASMPAA 587
           AAAA+  AA
Sbjct: 128 AAAAAAAAA 136

 Score = 45.1 bits (105), Expect = 8e-04
 Identities = 45/133 (33%), Positives = 53/133 (39%)
 Frame = +3

Query: 198 RSAAEACASAPAAKKPAAASTAIAAGAAAPLAMAGWTYPPLPMGMMPPMPMCMPGMGMFP 377
           ++AA A A A  A   AAA+ A AA AAA    A  T                       
Sbjct: 9   QAAAGAAAPAGTAAAAAAAAAAAAAAAAAAATGAAAT----------------------- 45

Query: 378 PFMGMGMFPPFWLPAAAMAAAAASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCA 557
                         AAA  AAAA+AA  + A   A   A +   AA AAA   A  A+ A
Sbjct: 46  -------------TAAAAGAAAAAAAATTAAAAAAAGAAATAGAAAAAAAAGAAATAAAA 92

Query: 558 AAAAASMPAAAPA 596
           A AAA+  AAA A
Sbjct: 93  AGAAATAEAAAGA 105

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 29/59 (49%), Positives = 34/59 (57%)
 Frame = +3

Query: 420 AAAMAAAAASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCAAAAAASMPAAAPA 596
           AAA AAAAA+AA  + AT  A AGA +   AA  AA   A  A+  A AAA+  AA  A
Sbjct: 28  AAAAAAAAAAAATGAAATTAAAAGAAAAAAAATTAAAAAAAGAAATAGAAAAAAAAGAA 86

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 30/59 (50%), Positives = 35/59 (58%)
 Frame = +3

Query: 420 AAAMAAAAASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCAAAAAASMPAAAPA 596
           AAA AAAAA+AA A+ AT  A   A +   AA AAA   A  A+ A AAA +  AAA A
Sbjct: 23  AAAAAAAAAAAAAAAAATGAAATTAAAAGAAAAAAAATTAAAAAAAGAAATAGAAAAAA 81

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 28/60 (46%), Positives = 32/60 (52%)
 Frame = +3

Query: 417 PAAAMAAAAASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCAAAAAASMPAAAPA 596
           PA   AAAAA+AA A+ A   A  GA +   AA  AA   A   + AAAAAA   A A A
Sbjct: 17  PAGTAAAAAAAAAAAAAAAAAAATGAAATTAAAAGAAAAAAAATTAAAAAAAGAAATAGA 76

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 31/68 (45%), Positives = 36/68 (52%)
 Frame = +3

Query: 393 GMFPPFWLPAAAMAAAAASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCAAAAAA 572
           G   P    AAA AAAAA+AA A+ A   A A   +   AA AAA      A+ AA AAA
Sbjct: 13  GAAAPAGTAAAAAAAAAAAAAAAAAAATGAAATTAAAAGAAAAAAAATTAAAAAAAGAAA 72

Query: 573 SMPAAAPA 596
           +  AAA A
Sbjct: 73  TAGAAAAA 80

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 29/59 (49%), Positives = 32/59 (54%)
 Frame = +3

Query: 420 AAAMAAAAASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCAAAAAASMPAAAPA 596
           AAA AAAA  AA  + A   A A A +   AA AAA   A  A  AAAAAA+  AA  A
Sbjct: 32  AAAAAAAATGAAATTAAAAGAAAAAAAATTAAAAAAAGAAATAGAAAAAAAAGAAATAA 90

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 28/59 (47%), Positives = 33/59 (55%)
 Frame = +3

Query: 420 AAAMAAAAASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCAAAAAASMPAAAPA 596
           AAA AAAAA+A GA+  T  A   A +   A  AAA   A  A+ A AAAA+  A A A
Sbjct: 29  AAAAAAAAAAATGAAATTAAAAGAAAAAAAATTAAAAAAAGAAATAGAAAAAAAAGAAA 87

 Score = 41.2 bits (95), Expect = 0.012
 Identities = 44/130 (33%), Positives = 49/130 (36%)
 Frame = +3

Query: 207 AEACASAPAAKKPAAASTAIAAGAAAPLAMAGWTYPPLPMGMMPPMPMCMPGMGMFPPFM 386
           A A A+APA    AAA+ A AA AAA  A  G                            
Sbjct: 10  AAAGAAAPAGTAAAAAAAAAAAAAAAAAAATG---------------------------- 41

Query: 387 GMGMFPPFWLPAAAMAAAAASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCAAAA 566
                      AA  AAAA +AA A+ AT  A A A      A AAA         AAAA
Sbjct: 42  ----------AAATTAAAAGAAAAAAAATTAAAAAAAGAAATAGAAA--------AAAAA 83

Query: 567 AASMPAAAPA 596
            A+  AAA A
Sbjct: 84  GAAATAAAAA 93

 Score = 40.8 bits (94), Expect = 0.015
 Identities = 28/59 (47%), Positives = 32/59 (53%)
 Frame = +3

Query: 420 AAAMAAAAASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCAAAAAASMPAAAPA 596
           AAA AAAAA+AA A+     A   A +   AA AAA   A  A+  AAA A   AAA A
Sbjct: 24  AAAAAAAAAAAAAAAATGAAATTAAAAGAAAAAAAATTAAAAAAAGAAATAGAAAAAAA 82

 Score = 40.4 bits (93), Expect = 0.020
 Identities = 28/61 (45%), Positives = 31/61 (49%)
 Frame = +3

Query: 414 LPAAAMAAAAASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCAAAAAASMPAAAP 593
           L   A A AAA A  A+ A   A A A +   AA  AA   A  A  AAAAAA+  AAA 
Sbjct: 6   LAVQAAAGAAAPAGTAAAAAAAAAAAAAAAAAAATGAAATTAAAAGAAAAAAAATTAAAA 65

Query: 594 A 596
           A
Sbjct: 66  A 66

 Score = 35.8 bits (81), Expect = 0.49
 Identities = 39/113 (34%), Positives = 42/113 (36%)
 Frame = -2

Query: 502 RLHAPAIAGIVATLAPAADAAAAAIAAAGSQNGGNMPMPINGGNMPIPGMHIGIGGIIPI 323
           +L   A AG  A    AA AAAAA AAA +                              
Sbjct: 5   QLAVQAAAGAAAPAGTAAAAAAAAAAAAAAAAAA-------------------------- 38

Query: 322 GRGGYVQPAIASGAAAPAAIAVDAAAGFFAAGAEAQASAAERFLLLTATAVMA 164
             G     A A+GAAA AA A  AAA   AAGA A A AA       A A  A
Sbjct: 39  ATGAAATTAAAAGAAAAAAAATTAAAA-AAAGAAATAGAAAAAAAAGAAATAA 90

>dbj|BAA20466.1| insoluble protein [Pinctada fucata]
          Length = 738

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 51/119 (42%), Positives = 59/119 (48%), Gaps = 1/119 (0%)
 Frame = -2

Query: 595 AGAAAGIEAAAAAAHDAIIAGHIAAACAAWGRLHAPAIAGIVATLAPAADAAAAAIAAAG 416
           AG AA   AAAAAA    + G  AAA AA     A A  G    L  AA AAAAA AAAG
Sbjct: 194 AGGAAAAAAAAAAAAGGGVGGAAAAAAAA-----AAAAGGGAGRLGGAAAAAAAAAAAAG 248

Query: 415 SQNGGNMPMPINGGNMPIPGMHIGIGGIIPI-GRGGYVQPAIASGAAAPAAIAVDAAAG 242
              G      + G    + G+  G+GG+  + G GGY       G+AA AA A  AAAG
Sbjct: 249 GAGG------LGGLGGGLGGLGGGLGGLGGLGGLGGY------GGSAAAAAAAAAAAAG 295

 Score = 48.5 bits (114), Expect = 7e-05
 Identities = 48/124 (38%), Positives = 55/124 (43%)
 Frame = -2

Query: 598 MAGAAAGIEAAAAAAHDAIIAGHIAAACAAWGRLHAPAIAGIVATLAPAADAAAAAIAAA 419
           + G   G  AAAAAA         AAA    GR    A+   +     AA AAAAA AAA
Sbjct: 501 LGGLGGGSAAAAAAA--------AAAASGGGGRALRRALRRQMRGGGSAAAAAAAAAAAA 552

Query: 418 GSQNGGNMPMPINGGNMPIPGMHIGIGGIIPIGRGGYVQPAIASGAAAPAAIAVDAAAGF 239
           G   GG M     GG     G  +G+GG    G GG        G++A AA A  AAAGF
Sbjct: 553 GGGWGGGM-----GG-----GFGVGLGGGFGGGFGG--------GSSAAAAAAAAAAAGF 594

Query: 238 FAAG 227
              G
Sbjct: 595 GGGG 598

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 57/187 (30%), Positives = 74/187 (39%), Gaps = 28/187 (14%)
 Frame = -2

Query: 598 MAGAAAGIEAAAAAAHDAIIAGHIAAACAAWGRLHAPA---------------------- 485
           + GAAA   AAAAAA     AG +  A AA     A A                      
Sbjct: 212 VGGAAAAAAAAAAAAGGG--AGRLGGAAAAAAAAAAAAGGAGGLGGLGGGLGGLGGGLGG 269

Query: 484 ---IAGIVATLAPAADAAAAAIAAAGSQNGGNMPMPINGGNMPIPGMHIGIGGIIPIGRG 314
              + G+      AA AAAAA AAAG            GG +   G + G GG    GRG
Sbjct: 270 LGGLGGLGGYGGSAAAAAAAAAAAAG------------GGGLGGVGFYGGRGGRRGRGRG 317

Query: 313 GYVQPAIASGAAAPAAI---AVDAAAGFFAAGAEAQASAAERFLLLTATAVMADMFEGQR 143
           G  + A A+ AAA AA          G    GA A A+AA      +A+  M+ + +   
Sbjct: 318 GRRRAAAAAAAAAAAAAGGGGGGGGGGGGGGGAGAAAAAAAAAASASASRQMSGIRDALG 377

Query: 142 NIRFLFK 122
           +I+ L +
Sbjct: 378 DIKDLLR 384

 Score = 37.4 bits (85), Expect = 0.17
 Identities = 24/51 (47%), Positives = 28/51 (54%)
 Frame = +3

Query: 420 AAAMAAAAASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCAAAAAA 572
           AAA AAAAA+AAG  V    A A A +      A  +  A  A+ AAAAAA
Sbjct: 197 AAAAAAAAAAAAGGGVGGAAAAAAAAAAAAGGGAGRLGGAAAAAAAAAAAA 247

 Score = 34.7 bits (78), Expect = 1.1
 Identities = 32/104 (30%), Positives = 44/104 (41%), Gaps = 10/104 (9%)
 Frame = -2

Query: 484 IAGIVATLAPAADAAAAAIAAAGSQNGGNMPMPINGGNMPIPGMHIG--IGGIIPIGRGG 311
           +AG++ + A A+ +A+A+ +A G   GGN      GGN    G   G     +   G GG
Sbjct: 416 LAGLLKSSASASASASASASAGGGGGGGN-----GGGNGGGGGGGAGALAAALAAAGAGG 470

Query: 310 YVQPAIASGAAAPAAIAVDAAAGFFA--------AGAEAQASAA 203
            +      GA A A  A  A  G F          G  A A+AA
Sbjct: 471 GLGGGGGGGALAAALAAAGAGGGGFGGLGGLGGLGGGSAAAAAA 514

 Score = 34.7 bits (78), Expect = 1.1
 Identities = 44/139 (31%), Positives = 57/139 (40%), Gaps = 1/139 (0%)
 Frame = +3

Query: 162 SAMTAVAVNNKKRSAAEACASAPAAKKPAAASTAIAAGAAAPLAMAGWTYPPLPMGMMPP 341
           +A  A A      +AA A A+A AA   A      AA AAA  A AG        G +  
Sbjct: 202 AAAAAAAGGGVGGAAAAAAAAAAAAGGGAGRLGGAAAAAAAAAAAAGGA------GGLGG 255

Query: 342 MPMCMPGMGM-FPPFMGMGMFPPFWLPAAAMAAAAASAAGASVATMPAMAGACSLPQAAQ 518
           +   + G+G       G+G    +   AAA AAAAA+AAG          G     +   
Sbjct: 256 LGGGLGGLGGGLGGLGGLGGLGGYGGSAAAAAAAAAAAAGGGGLGGVGFYGGRGGRRGRG 315

Query: 519 AAAMWPAMMASCAAAAAAS 575
                 A  A+ AAAAAA+
Sbjct: 316 RGGRRRAAAAAAAAAAAAA 334

 Score = 32.3 bits (72), Expect = 5.4
 Identities = 26/57 (45%), Positives = 31/57 (53%)
 Frame = +3

Query: 420 AAAMAAAAASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCAAAAAASMPAAA 590
           A   AAAAA+AA A+      + GA +   AA AAA   A     AAAAAA+  AAA
Sbjct: 194 AGGAAAAAAAAAAAAGG---GVGGAAAAAAAAAAAAGGGAGRLGGAAAAAAAAAAAA 247

>emb|CAA56558.1| pprB [Pseudomonas putida]
          Length = 298

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 62/190 (32%), Positives = 74/190 (38%), Gaps = 16/190 (8%)
 Frame = +3

Query: 75  GKGRCSACR---DRAVSTSLKRNLILRCPSNMSAMTAVAVNNKKRSAAEACASAPA--AK 239
           GK R +A +    RAV+    +    + P+  +A    A    K +A  A A APA  A 
Sbjct: 120 GKVREAASKALVQRAVAVKAAKPAAAKAPAKAAATKPAARTAAKPAAKAATAKAPAKAAA 179

Query: 240 KPAAASTAIAAGAAAPLAMAGWTYPPLPMGMMPPMPMCMPGMGMFPPFMGMGMFPPFWLP 419
           KPAAA       AA P A                 P   P  G  P         P   P
Sbjct: 180 KPAAAKAPAKTAAAKPAAK----------------PAAKPAAGKAPAKAAAAK--PAAKP 221

Query: 420 AAAMAAAAASAA--GASVATMPAMAGACSLPQAAQAAAMWPAMMA---------SCAAAA 566
           AAA A A A+AA   A  A   A A   + P AA+ A   PA  A         S A A 
Sbjct: 222 AAAKAPAKAAAAKPAAKPAAAKAPAKPAAKPAAAKPAETKPATAATSTPAAATNSAAPAT 281

Query: 567 AASMPAAAPA 596
           AAS PA+ PA
Sbjct: 282 AASAPASTPA 291

>ref|NP_742363.1| alginate regulatory protein AlgP [Pseudomonas putida KT2440]
           gi|24981549|gb|AAN65827.1|AE016211_5 alginate regulatory
           protein AlgP [Pseudomonas putida KT2440]
          Length = 329

 Score = 52.0 bits (123), Expect = 7e-06
 Identities = 51/145 (35%), Positives = 57/145 (39%)
 Frame = +3

Query: 162 SAMTAVAVNNKKRSAAEACASAPAAKKPAAASTAIAAGAAAPLAMAGWTYPPLPMGMMPP 341
           +A    A     + AA A A+A  A KPAA +T  A  AA P A A     P        
Sbjct: 138 AAKATAAAKPAAKPAARATAAAKPAAKPAAKTTTAAKPAAKPAAKATAAAKPAAKPAAKA 197

Query: 342 MPMCMPGMGMFPPFMGMGMFPPFWLPAAAMAAAAASAAGASVATMPAMAGACSLPQAAQA 521
                P     P         P   PAA  A AAA  A    A   A A   + P A  A
Sbjct: 198 TAAAKPAAK--PAAKATAAAKPAAKPAAK-ATAAAKPAAKPAAKATAAAKPAAKPAAKAA 254

Query: 522 AAMWPAMMASCAAAAAASMPAAAPA 596
           AA  PA  A  AA A A+ PAA PA
Sbjct: 255 AAAKPA--AKPAAKAPAAKPAAKPA 277

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 52/171 (30%), Positives = 66/171 (38%)
 Frame = +3

Query: 84  RCSACRDRAVSTSLKRNLILRCPSNMSAMTAVAVNNKKRSAAEACASAPAAKKPAAASTA 263
           + +A    A   + +     +  +  +A T  A     + AA+A A+A  A KPAA +TA
Sbjct: 140 KATAAAKPAAKPAARATAAAKPAAKPAAKTTTAAKPAAKPAAKATAAAKPAAKPAAKATA 199

Query: 264 IAAGAAAPLAMAGWTYPPLPMGMMPPMPMCMPGMGMFPPFMGMGMFPPFWLPAAAMAAAA 443
            A  AA P A A     P             P               P     AA   AA
Sbjct: 200 AAKPAAKPAAKATAAAKPAAKPAAKATAAAKPAA------------KPAAKATAAAKPAA 247

Query: 444 ASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCAAAAAASMPAAAPA 596
             AA A+ A  PA   A   P A  AA   PA  A+ A A  A+ PAA PA
Sbjct: 248 KPAAKAAAAAKPAAKPAAKAPAAKPAAK--PA--ATKAPARTAAKPAAKPA 294

 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 48/133 (36%), Positives = 54/133 (40%)
 Frame = +3

Query: 198 RSAAEACASAPAAKKPAAASTAIAAGAAAPLAMAGWTYPPLPMGMMPPMPMCMPGMGMFP 377
           + AA+A A+A  A KPAA +TA A  AA P A       P             P     P
Sbjct: 136 KPAAKATAAAKPAAKPAARATAAAKPAAKPAAKTTTAAKPAAKPAAKATAAAKPAAK--P 193

Query: 378 PFMGMGMFPPFWLPAAAMAAAAASAAGASVATMPAMAGACSLPQAAQAAAMWPAMMASCA 557
                    P   PAA  A AAA  A    A   A A   + P A   AA  PA   +  
Sbjct: 194 AAKATAAAKPAAKPAAK-ATAAAKPAAKPAAKATAAAKPAAKPAAKATAAAKPAAKPAAK 252

Query: 558 AAAAASMPAAAPA 596
           AAAAA  PAA PA
Sbjct: 253 AAAAAK-PAAKPA 264

>ref|ZP_00092324.1| COG0654: 2-polyprenyl-6-methoxyphenol hydroxylase and related
           FAD-dependent oxidoreductases [Azotobacter vinelandii]
          Length = 698

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 49/145 (33%), Positives = 62/145 (41%), Gaps = 7/145 (4%)
 Frame = -1

Query: 599 HGWGRSGHRGGRGRCARRHHRGPHRCGLRSLGQAACPRHRGHRRYTRPR---R*CSSCGH 429
           HG G     GG G  ARR  R   R GL++L  A C    GH R  R R   R   +   
Sbjct: 174 HGAGDHRRTGGAGAAARRGRRTDRRRGLQALLHAPCRSLAGHGRARRRRLQDRRSVAPAR 233

Query: 428 RGGRQPKRGEHAHAHK----RGEHAHSRHAHRHRRHHTHRQRWVRPTCHRQRRSSAGRNC 261
            G    +R  H +  +    R E A  R AHR  R  +HR R   P  HR+R     R+ 
Sbjct: 234 TGHDDDRRAGHLYRRRQRQGRAEMARHRRAHR-GRCGSHRVRLRDP--HRRRAQERRRD- 289

Query: 260 C*RGSRLLRSRSRGASLGRRALLVV 186
             RG+    +R  G S+ R  L +V
Sbjct: 290 --RGTDGRDTRPGGLSMARVELAIV 312



EST assemble image


clone accession position
1 LCL031e07_r AV627755 1 360
2 LCL087h12_r AV631039 1 486
3 HCL024g11_r AV640926 1 488
4 HCL075d08_r AV643754 2 489
5 HCL079a09_r AV643954 2 412
6 HCL030g11_r AV641270 2 463
7 HCL064a06_r AV643115 3 488
8 LCL026d05_r AV627415 6 487
9 CL38b07_r AV395304 8 364
10 CL02d07_r AV397622 8 561
11 HCL092h05_r AV644722 11 198
12 LCL002e04_r AV626109 12 247
13 LCL060g05_r AV629549 16 400
14 MXL098c12_r BP098742 21 390
15 MXL003g03_r BP093122 157 607




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research