KCC000048A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000048A_C01 KCC000048A_c01
ttAAAGCAACTAGAACTCATGAACACCCTTCAGCAGCAACGTCTCCTGAGCCCCGTCGGC
TCGATTCCTTGCAAACCAACGAACCCAGACACCGGGCCTTGCGCACCTGCATCTCCCGAC
TGCTATAGCCCTAGCAACCTGAACATGCACCAGGCAGCAGGACCAGCAGATGCTCGACGA
CGGAGCCCCGGCTCAGCAGAATTCGGCGAGCAATCGCTCTTACCCGGACAGCCGGAGGCC
CGTTCCCAGCAACAAGTACAACGGCAGACACCTGATGCTGCAGATGTCATACGGGCACTA
GAGGACTGCCTGCAAGAACTCTGCGGCGCTTCTTGCGGGTCTGCGCCACTGGCCATCGGG
CAGCGCGGCGAGGGCTGCCTGCGCTCGGAGCTCATTAACCGATACGTCCTCTCCTCGTTG
TACGCTTGCGAGCTGTCTGGAGCGCAGCTCGCCGCGGGGAGCGGGGGCTGCTGCCCCGGC
ACGCCCAGCGAGAGCGGAGTTGGCGGACTCGTCCCGGACACCATGTCCAAGGCCATGAAC
AACTGCGAGCGCGCCCTAG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000048A_C01 KCC000048A_c01
         (559 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

prf||1923401A protein CBP                                              41  0.012
ref|NP_536350.1| guanine nucleotide binding protein (G protein),...    40  0.028
emb|CAA12165.1| GNAS1 [Homo sapiens] gi|10086225|emb|CAC07998.1|...    40  0.028
emb|CAB83215.1| XLalphas protein [Homo sapiens] gi|10086224|emb|...    40  0.028
ref|ZP_00056820.1| COG2115: Xylose isomerase [Thermobifida fusca]      35  0.031

>prf||1923401A protein CBP
          Length = 2441

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 29/87 (33%), Positives = 40/87 (45%), Gaps = 3/87 (3%)
 Frame = +1

Query: 4    KQLELMNT--LQQQRLLSPVGSIPCKPTNPDTGPCAPASPDCYSPSNLNMHQAAGPADAR 177
            +++  MNT  + QQ L SP  + P  PT   + P  P  P    PS +NM  A  P  AR
Sbjct: 1868 RRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVNMSPAGFPNVAR 1927

Query: 178  RRSPGSAEFGE-QSLLPGQPEARSQQQ 255
             + P     G+  + +P  P    QQQ
Sbjct: 1928 TQPPTIVSAGKPTNQVPAPPPPAPQQQ 1954

>ref|NP_536350.1| guanine nucleotide binding protein (G protein), alpha stimulating
           activity polypeptide 1 isoform XL-alpha-s;
           neuroendocrine secretory protein 55; guanine nucleotide
           binding protein (G protein), alpha stimulating activity
           polypeptide 1; paternally expressed G protein XL alpha
           S; guanine nucleotide regulatory protein; G-s-alpha;
           adenylate cyclase-stimulating G alpha protein [Homo
           sapiens]
          Length = 909

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 2/82 (2%)
 Frame = +1

Query: 58  GSIPCKPTNPDTG--PCAPASPDCYSPSNLNMHQAAGPADARRRSPGSAEFGEQSLLPGQ 231
           G+ P  P +PD+G  P APA PD  +  +      AG A     +P +AE     + P  
Sbjct: 304 GAAPAAPADPDSGAAPDAPADPDSGAAPDAPADPDAGAAPEAPAAPAAAETRAAHVAPAA 363

Query: 232 PEARSQQQVQRQTPDAADVIRA 297
           P+A +          AA V RA
Sbjct: 364 PDAGAPTAPAASATRAAQVRRA 385

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 8/75 (10%)
 Frame = +2

Query: 353 PSGSAARAACARSSLTDTSSPRCTLASCLERSSPRGAGAAAPARPARAEL--------AD 508
           P+ +  RAA    +  D  +P    AS    +  R A +AAPA  AR ++          
Sbjct: 349 PAAAETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSPEIQ 408

Query: 509 SSRTPCPRP*TTASA 553
           ++  P PRP T ASA
Sbjct: 409 AADPPTPRP-TRASA 422

>emb|CAA12165.1| GNAS1 [Homo sapiens] gi|10086225|emb|CAC07998.1| dJ806M20.3.2
           (isoform 2 of guanine nucleotide binding protein (G
           protein), alpha stimulating activity polypeptide 1)
           [Homo sapiens]
          Length = 441

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 2/82 (2%)
 Frame = +1

Query: 58  GSIPCKPTNPDTG--PCAPASPDCYSPSNLNMHQAAGPADARRRSPGSAEFGEQSLLPGQ 231
           G+ P  P +PD+G  P APA PD  +  +      AG A     +P +AE     + P  
Sbjct: 131 GAAPAAPADPDSGAAPDAPADPDSGAAPDAPADPDAGAAPEAPAAPAAAETRAAHVAPAA 190

Query: 232 PEARSQQQVQRQTPDAADVIRA 297
           P+A +          AA V RA
Sbjct: 191 PDAGAPTAPAASATRAAQVRRA 212

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 8/75 (10%)
 Frame = +2

Query: 353 PSGSAARAACARSSLTDTSSPRCTLASCLERSSPRGAGAAAPARPARAEL--------AD 508
           P+ +  RAA    +  D  +P    AS    +  R A +AAPA  AR ++          
Sbjct: 176 PAAAETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSPEIQ 235

Query: 509 SSRTPCPRP*TTASA 553
           ++  P PRP T ASA
Sbjct: 236 AADPPTPRP-TRASA 249

>emb|CAB83215.1| XLalphas protein [Homo sapiens] gi|10086224|emb|CAC07997.1|
           dJ806M20.3.1 (isoform 1 of guanine nucleotide binding
           protein (G protein), alpha stimulating activity
           polypeptide 1) [Homo sapiens]
          Length = 388

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 2/82 (2%)
 Frame = +1

Query: 58  GSIPCKPTNPDTG--PCAPASPDCYSPSNLNMHQAAGPADARRRSPGSAEFGEQSLLPGQ 231
           G+ P  P +PD+G  P APA PD  +  +      AG A     +P +AE     + P  
Sbjct: 131 GAAPAAPADPDSGAAPDAPADPDSGAAPDAPADPDAGAAPEAPAAPAAAETRAAHVAPAA 190

Query: 232 PEARSQQQVQRQTPDAADVIRA 297
           P+A +          AA V RA
Sbjct: 191 PDAGAPTAPAASATRAAQVRRA 212

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 8/75 (10%)
 Frame = +2

Query: 353 PSGSAARAACARSSLTDTSSPRCTLASCLERSSPRGAGAAAPARPARAEL--------AD 508
           P+ +  RAA    +  D  +P    AS    +  R A +AAPA  AR ++          
Sbjct: 176 PAAAETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSPEIQ 235

Query: 509 SSRTPCPRP*TTASA 553
           ++  P PRP T ASA
Sbjct: 236 AADPPTPRP-TRASA 249

>ref|ZP_00056820.1| COG2115: Xylose isomerase [Thermobifida fusca]
          Length = 754

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 36/133 (27%), Positives = 49/133 (36%), Gaps = 14/133 (10%)
 Frame = -3

Query: 512 TSPPTPL--------SLGVPGQQPPLPAASCAPDSSQAYNEERT------YRLMSSERRQ 375
           +SPP PL        S   P   PP PAAS +  +S A N   T          S E   
Sbjct: 184 SSPPEPLRSASPSKNSTNSPSPHPPAPAASSSCPTSTA-NAPPTCPTPPAASTASPEPTS 242

Query: 374 PSPRCPMASGADPQEAPQSSCRQSSSARMTSAASGVCRCTCCWERASGCPGKSDCSPNSA 195
           P P  P  S      A  +    SS+    S  S          +++  P KS  +P+ +
Sbjct: 243 PPPTWPAPSSKACSAASLTPSTPSSTKVSPSTVSSSSAAAPAPPQSAPSPPKSSAAPSPS 302

Query: 194 EPGLRRRASAGPA 156
           +P      +A PA
Sbjct: 303 QPKANTSPTAPPA 315

 Score = 31.2 bits (69), Expect(2) = 0.031
 Identities = 21/59 (35%), Positives = 23/59 (38%), Gaps = 2/59 (3%)
 Frame = +1

Query: 76  PTNPDTGPCAPASPDCYSPSNLNMHQAAG--PADARRRSPGSAEFGEQSLLPGQPEARS 246
           PT P   P +P  PD  SPS+    Q A   P   R  SP        S  P  P A S
Sbjct: 156 PTPPAPSPDSPTPPDASSPSSAPSTQPASSPPEPLRSASPSKNSTNSPSPHPPAPAASS 214

 Score = 27.3 bits (59), Expect(2) = 0.031
 Identities = 24/61 (39%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +2

Query: 350 WPSGSAARAACARSSLTDTSSPRCTLASCLERSSPRGAGAAAPARPARA-ELADSSRTPC 526
           WP+ S+   AC+ +SLT  S+P  T  S    S+   + AAAPA P  A     SS  P 
Sbjct: 247 WPAPSSK--ACSAASLT-PSTPSSTKVS---PSTVSSSSAAAPAPPQSAPSPPKSSAAPS 300

Query: 527 P 529
           P
Sbjct: 301 P 301



EST assemble image


clone accession position
1 CL18b02_r AV394040 1 469
2 CL02d05_r AV397594 3 559




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research