KCC000047A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000047A_C01 KCC000047A_c01
cggggcaagcggctgcggactgtgcagggatggcagcgcgcgccttttgtggtgtggtga
gcacagggcGAGGGGACGGAAGATGCTTTTGCGTCGGCGCACGGAAAGCCGGGGGCGGGG
TCATATGCCCTGCACACACGGGGGCGTTGATGAAGTGTGCACGGGGCGCGCTACCGGTTC
TGGGGGGGAGTAAGAGCTTGTATGAACTGGACTGGCATCGCTGCGTGTGCGTGTCTGGGA
GCCAGCTGCGTCTGGCGTGTGTCCCGGAGTTTTCGTGCTCGCTTCCGGGCCTCAGCCGTC
CCCTTGTCCTGATCAATCCTAATGAGGGCGTTACGTGAAGAGAGATCCTATACCTATCAT
CGAGTAGATCGTGGAGGGGTCGGCGGCGGTTGCTTTGGGCGTCGCCGCCGCCGCCTCACT
CCGAGACGTAATGTCTGTGCCCCCATGCCGGCATGCGGCGCGGGAGGCCTCGGAGAACTC
GAGGTTGTGCGGAGCAGGCCGCGAATTTGAAGCGGCCCTAGTTCTGGCACGCCCTCACAC
ATTGGTCGTGAGCGGTGGAGACGGTGCGGAGGGCTTGGTTTTGCTGATCGGCAGGGCTGC
CTCCGTCCGTGGGTTGATTCGGCTTTTGTCTCAGGCGGGGTACTGGTAGCCTCTAGACTG
GGCAAAAGTAGGCTTAAAAACTTGAAACATACGTCGTAGTTTGTGGGTACAGAAGTATTT
CTTTTGTGGTTGGTTGAGACTGAATGCGCACCTGGTATGGGTGTTGGTGAGGGTTCTCCC
CTGCCGCGGACGCTAAGCCACGCTGGCATGCCCACGGGGCGGTCGGCAGCTTGCGCCGTC
ACATGGATATGCAGGCAGCAGCACTCGGGAGGGCGGGTGGATGTGCGCGTGATGCGTTCC
CCCGCCTGCCCGTGCCCGTGCCGCCTTCCATAACACAGAGCAGGAGGATGGCGAGGGATA
AGAGTTGCTTGATACACAAATGTGTTTGATCTATGGGTTAAGTTGGTGCAACGGCTACGA
ATGGTACCCCGCAAGAGATGTGAGGTAACAACCGACGCAGAGGCGGTGGCGGAGAGGTCA
ACACGATGCAGTGGACGTGTGCCATGGGCATGGAGCGCGCGCGCCGGTGGCGGGCCGCAT
AGGCATATGCCCACGTGCGGCATGACCGTCTGCCGTGTCTGTAACCTGTTCGGCATGG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000047A_C01 KCC000047A_c01
         (1198 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAF64523.1| cervical mucin MUC5B [Homo sapiens]                     49  2e-04
ref|XP_039877.6| similar to Mucin 5B precursor (Mucin 5 subtype ...    43  0.001
ref|NP_198672.1| protein kinase family [Arabidopsis thaliana] gi...    36  0.001
sp|Q9Y3L3|3BP1_HUMAN SH3-domain binding protein 1 (3BP-1)              44  0.007
ref|XP_352404.1| similar to contains similarity to cell wall-pla...    44  0.007

>gb|AAF64523.1| cervical mucin MUC5B [Homo sapiens]
          Length = 716

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 48/162 (29%), Positives = 67/162 (40%), Gaps = 5/162 (3%)
 Frame = -2

Query: 606 TEAALPISKTKPSAPSPPL-TTNV*GRARTRAASNSRP----APHNLEFSEASRAACRHG 442
           T A  P + +    PS  L TT+      T A ++ R     +PH +  +  S  +   G
Sbjct: 68  TTATTPAATSNTVTPSSALGTTHTPPVPNTTATTHGRSLSPSSPHTVRTAWTSATSGTLG 127

Query: 441 GTDITSRSEAAAATPKATAADPSTIYSMIGIGSLFT*RPH*D*SGQGDG*GPEASTKTPG 262
            T IT  S   + TP AT    +T +S   + S     PH   S   +   P   T TPG
Sbjct: 128 TTHITEPSTGTSHTPAATTG--TTQHSTPALSS-----PHPSSSRTTES-PPSPGTTTPG 179

Query: 261 HTPDAAGSQTRTRSDASPVHTSSYSPPEPVARPVHTSSTPPC 136
           HT   A S+T   +  S   TS+  P  P + P+ T  T  C
Sbjct: 180 HT--TATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTTGC 219

>ref|XP_039877.6| similar to Mucin 5B precursor (Mucin 5 subtype B, tracheobronchial)
            (High molecular weight salivary mucin MG1) (Sublingual
            gland mucin) [Homo sapiens]
          Length = 5858

 Score = 43.1 bits (100), Expect(2) = 0.001
 Identities = 47/162 (29%), Positives = 66/162 (40%), Gaps = 5/162 (3%)
 Frame = -2

Query: 606  TEAALPISKTKPSAPSPPL-TTNV*GRARTRAASNSRP----APHNLEFSEASRAACRHG 442
            T A  P + +    PS  L TT+      T A ++ R     +PH +  +  S  +   G
Sbjct: 2315 TTATTPAATSNTVTPSSALGTTHTPPVPNTMATTHGRSLPPSSPHTVRTAWTSATSGILG 2374

Query: 441  GTDITSRSEAAAATPKATAADPSTIYSMIGIGSLFT*RPH*D*SGQGDG*GPEASTKTPG 262
             T IT  S   + T  AT    +T +S   + S     PH   S +     P   T TPG
Sbjct: 2375 TTHITEPSTVTSHTLAATTG--TTQHSTPALSS-----PHP--SSRTTESPPSPGTTTPG 2425

Query: 261  HTPDAAGSQTRTRSDASPVHTSSYSPPEPVARPVHTSSTPPC 136
            HT   A S+T   +  S   TS+  P  P + P+ T  T  C
Sbjct: 2426 HT--TATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTMGC 2465

 Score = 21.9 bits (45), Expect(2) = 0.001
 Identities = 18/70 (25%), Positives = 26/70 (36%), Gaps = 5/70 (7%)
 Frame = -3

Query: 806  PAWLSVRG----RGEP-SPTPIPGAHSVSTNHKRNTSVPTNYDVCFKFLSLLLPSLEATS 642
            P W+S       RG   +P+ IPG     T H       T   V    ++    S + + 
Sbjct: 2225 PVWISTTTTPTTRGSTVTPSSIPG-----TTHTATVLTTTTTTVATGSMATPSSSTQTSG 2279

Query: 641  TPPETKAEST 612
            TPP     +T
Sbjct: 2280 TPPSLTTTAT 2289

>ref|NP_198672.1| protein kinase family [Arabidopsis thaliana]
           gi|10176824|dbj|BAB10146.1| contains similarity to
           protein kinase~gene_id:MBB18.10 [Arabidopsis thaliana]
           gi|15983497|gb|AAL11616.1|AF424623_1 AT5g38560/MBB18_10
           [Arabidopsis thaliana] gi|18700153|gb|AAL77688.1|
           AT5g38560/MBB18_10 [Arabidopsis thaliana]
           gi|21360463|gb|AAM47347.1| AT5g38560/MBB18_10
           [Arabidopsis thaliana]
          Length = 681

 Score = 36.2 bits (82), Expect(2) = 0.001
 Identities = 29/92 (31%), Positives = 39/92 (41%), Gaps = 5/92 (5%)
 Frame = -2

Query: 288 PEASTKTPGHTPDAAGSQTRTR--SDASPVHTSSYSPPEPVAR---PVHTSSTPPCVQGI 124
           P+ S   PG TP   G        S ++P  T++ SPP P A    P  ++ T P     
Sbjct: 135 PKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAP 194

Query: 123 *PRPRLSVRRRKSIFRPLALCSPHHKRRALPS 28
            P P   V R K I +P    S ++    LPS
Sbjct: 195 PPTPLPVVPREKPIAKPTGPAS-NNGNNTLPS 225

 Score = 28.9 bits (63), Expect(2) = 0.001
 Identities = 31/117 (26%), Positives = 40/117 (33%), Gaps = 13/117 (11%)
 Frame = -3

Query: 677 LSLLLP--SLEATSTPPETKAESTHGRRQPCRSAKPSPPHRLHR-----------SRPMC 537
           L +L P  S  +T+ PP  + + T     P  +  PSPP                S P  
Sbjct: 7   LPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPP 66

Query: 536 EGVPELGPLQIRGLLRTTSSSPRPPAPHAGMGAQTLRLGVRRRRRRPKQPPPTPPRS 366
              P   P  I     T +SSP PP   A     T           P   PP PP++
Sbjct: 67  SSSPPPSPPVITSPPPTVASSPPPPVVIASPPPST-----------PATTPPAPPQT 112

>sp|Q9Y3L3|3BP1_HUMAN SH3-domain binding protein 1 (3BP-1)
          Length = 622

 Score = 43.5 bits (101), Expect = 0.007
 Identities = 40/139 (28%), Positives = 54/139 (38%), Gaps = 5/139 (3%)
 Frame = -3

Query: 773 PSPTPIPGAHSVSTNHKRNTSVPTNYDVCFKFLSLLLPSLEATSTPPETKAESTHGRRQP 594
           P+P P P   S +T  +  + VP               S + T +PPET A      R  
Sbjct: 438 PAPAPAPALASAATKERTESEVPPR-----------PASPKVTRSPPETAAPVEDMAR-- 484

Query: 593 CRSAKPSPPHRLHRSRPMCEGVPELGPLQIRGLLRTTSSSPRPPAPHAGMGAQTLRLGVR 414
            R+ +P+P              P + P Q+ G   + SS P PP P  G G+      + 
Sbjct: 485 -RTKRPAPAR------------PTMPPPQVSG---SRSSPPAPPLP-PGSGSPGTPQALP 527

Query: 413 RR-----RRRPKQPPPTPP 372
           RR      R P  PPP PP
Sbjct: 528 RRLVGSSLRAPTVPPPLPP 546

>ref|XP_352404.1| similar to contains similarity to cell wall-plasma membrane linker
            protein~gene_id:MKA23.5 [Homo sapiens]
          Length = 1000

 Score = 43.5 bits (101), Expect = 0.007
 Identities = 69/268 (25%), Positives = 90/268 (32%), Gaps = 19/268 (7%)
 Frame = -3

Query: 1133 PPPARALHAHGTRPLHRVDLSATASASVVTSHLLRGT--IRSRCTNLT---------HRS 987
            PPP R  H     P   +  S  +S S    H +     +RS  T  T         HR 
Sbjct: 331  PPPQRPHH-----PDSVLTASTASSLSPQCPHCVHSVLNVRSALTAPTASSPPPQRPHRP 385

Query: 986  NTFVYQATLIPRHPPALCYGRRHGHGQAGERITRTSTRPPECCCLHIHVTAQAAD----- 822
            ++ V  A      PP     R HG        T  S RP      H  +TA  A      
Sbjct: 386  DS-VLTAPTASSPPPQ----RPHGVHSVLTAPTAPSPRPQRPHRPHSVLTAPTASSPPPQ 440

Query: 821  RPVGMPAWLSVRGRGEPSPTPIPGAHSVSTNHKRNTSVPTNYDVCFKFLSLLLPSLEATS 642
            RP G+ + L+      PSP      HSV T     +  P         L+ L        
Sbjct: 441  RPHGVHSVLTASTASSPSPQCPHRVHSVLTAPTAPSPRPQRPHRVHSVLTALTAPSPRPQ 500

Query: 641  TPPETKAESTHGRRQPCRSAKPSPPHRLHR--SRPMCEGVPELGPLQIRGLLRT-TSSSP 471
             P    +  T        S +P  PHR+H   + P         P ++  +L   T+ SP
Sbjct: 501  RPHRVHSVLTV---PTASSRRPQRPHRVHSVLTAPTASSQRPQRPHRVHSVLTAPTAPSP 557

Query: 470  RPPAPHAGMGAQTLRLGVRRRRRRPKQP 387
            RP  PH      T      R R+RP  P
Sbjct: 558  RPQRPHRPDSVLTAPTASSRPRQRPHGP 585



EST assemble image


clone accession position
1 MX062a02_r BP088498 1 338
2 MX067d04_r BP088726 70 403
3 HC020g03_r AV633432 118 382
4 HC043e12_r AV635227 241 723
5 CL02d03_r AV397618 611 1140
6 HCL008h11_r AV640021 613 1133
7 HCL007a06_r AV639907 756 1200
8 LCL084a04_r AV630763 926 1241
9 LCL013g09_r AV626692 944 1194




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research