KCC000046A_c03_1
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000046A_C03_1 KCC000046A_c03_1
CTAGGAGCCTGCCAAAATGGTCATGCAGGGGAACTTCAAGTTCCACCAGTACCAGGTGGT
GGGCCGCCACCTGCCCACTGCCGCGGATGCCAACCCCACCGTCTACCGCATGAAGGTGTG
GGCCGAGGATGACGTCAAGGCCAAGAGCAAGTTCTGGTACTTCCTGAGGAAGCTTCGCCG
TGTGAAGAAGGCCAACGGTCAGATCATTGCTTGCAACGAGATCTTCGAGCGCAAGCCCAC
CCTGGCCAAGCAACTACGTGCATCTAGGGTTCGCTACCATGTCGCGCACTGGTGCGTGCA
CAACATGTACACAGGAGTACCTGCGACGTGACCCTGAACGGCTCCGTCTCCCAGATGTAC
CAGGAGATGGCCTCGCGCCACCGCGTGCGCCCCTCGTCCATCCAGATCATCAAGACCGCC
ACCGTGGACTACCACAGCTGCAAGCGTGCCAACACCAAGCAGTTCCACAACGAGAAGATC
AGCTTCCCGGTCACCCAGAAGCTGGCTCGCCCCTCGTCGGCCACCTTCCGCACCCTGTTC
AAGGCCAACCGCCCCAACGTTGCTATGTTCTAAGGCGGCCTCTCGGTCCGGCTTAGCGGT
GCCACTGGGCCGGTGGACAGACGCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000046A_C03_1 KCC000046A_c03_1
         (625 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|Q943F3|RL1X_ORYSA 60S ribosomal protein L18a gi|15623861|dbj|...   117  2e-49
ref|NP_180995.1| 60S ribosomal protein L18A (RPL18aB) [Arabidops...   115  4e-49
sp|Q9ATF5|RL1X_CASSA 60S ribosomal protein L18a gi|13430184|gb|A...   113  3e-47
ref|NP_188078.1| 60S ribosomal protein L18A (RPL18aC) [Arabidops...   112  4e-47
gb|AAM65890.1| putative 60S ribosomal protein L18A [Arabidopsis ...   112  1e-46

>sp|Q943F3|RL1X_ORYSA 60S ribosomal protein L18a gi|15623861|dbj|BAB67920.1| putative
           ribosomal protein L18a, cytosolic [Oryza sativa
           (japonica cultivar-group)] gi|20160589|dbj|BAB89536.1|
           putative ribosomal protein L18a, cytosolic [Oryza sativa
           (japonica cultivar-group)]
          Length = 178

 Score =  117 bits (294), Expect(2) = 2e-49
 Identities = 57/94 (60%), Positives = 71/94 (74%)
 Frame = +2

Query: 29  GNFKFHQYQVVGRHLPTAADANPTVYRMKVWAEDDVKAKSKFWYFLRKLRRVKKANGQII 208
           G F+FHQYQVVGR LPT  D +P +YRMK+WA ++V+AKSKFWYFLRKL++VKK+NGQI+
Sbjct: 2   GAFRFHQYQVVGRGLPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQIL 61

Query: 209 ACNEIFERKPTLAKQLRASRVRYHVAHWCVHNMY 310
           A NEIFE+ PT  K      +RY  +    HNMY
Sbjct: 62  AINEIFEKNPTTIKNY-GIWLRYQ-SRTGYHNMY 93

 Score =  100 bits (249), Expect(2) = 2e-49
 Identities = 49/88 (55%), Positives = 61/88 (68%)
 Frame = +1

Query: 304 HVHRSTCDVTLNGSVSQMYQEMASRHRVRPSSIQIIKTATVDYHSCKRANTKQFHNEKIS 483
           ++++   D TLNG+V QMY EMASRHRVR   IQIIKTATV +  CKR NTKQFH   I 
Sbjct: 91  NMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHKSDIK 150

Query: 484 FPVTQKLARPSSATFRTLFKANRPNVAM 567
           FP+  +  RP +   +T FKA+RPN+ M
Sbjct: 151 FPLVYRKVRPPTRKLKTTFKASRPNLFM 178

>ref|NP_180995.1| 60S ribosomal protein L18A (RPL18aB) [Arabidopsis thaliana]
           gi|21431842|sp|P51418|RL1X_ARATH 60S ribosomal protein
           L18a-1 gi|7440926|pir||T02335 ribosomal protein L18a,
           cytosolic - Arabidopsis thaliana
           gi|3128228|gb|AAC26708.1| 60S ribosomal protein L18A
           [Arabidopsis thaliana] gi|14596031|gb|AAK68743.1|
           Unknown protein [Arabidopsis thaliana]
           gi|20197170|gb|AAM14956.1| 60S ribosomal protein L18A
           [Arabidopsis thaliana] gi|21539567|gb|AAM53336.1| 60S
           ribosomal protein L18A [Arabidopsis thaliana]
           gi|23197736|gb|AAN15395.1| 60S ribosomal protein L18A
           [Arabidopsis thaliana] gi|30102898|gb|AAP21367.1|
           At2g34480 [Arabidopsis thaliana]
          Length = 178

 Score =  115 bits (288), Expect(2) = 4e-49
 Identities = 55/94 (58%), Positives = 70/94 (73%)
 Frame = +2

Query: 29  GNFKFHQYQVVGRHLPTAADANPTVYRMKVWAEDDVKAKSKFWYFLRKLRRVKKANGQII 208
           G F+FHQYQVVGR LPT  D  P +YRMK+WA ++V+AKSKFWYFLRKL++VKK+NGQ++
Sbjct: 2   GAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQML 61

Query: 209 ACNEIFERKPTLAKQLRASRVRYHVAHWCVHNMY 310
           A NEI+E+ PT  K      +RY  +    HNMY
Sbjct: 62  AINEIYEKNPTTIKNF-GIWLRYQ-SRTGYHNMY 93

 Score =  101 bits (252), Expect(2) = 4e-49
 Identities = 50/88 (56%), Positives = 62/88 (69%)
 Frame = +1

Query: 304 HVHRSTCDVTLNGSVSQMYQEMASRHRVRPSSIQIIKTATVDYHSCKRANTKQFHNEKIS 483
           ++++   D TLNG+V QMY EMASRHRVR   IQIIKTATV    CKR +TKQFHN KI 
Sbjct: 91  NMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIK 150

Query: 484 FPVTQKLARPSSATFRTLFKANRPNVAM 567
           FP+  +  RP S   +T +KAN+PN+ M
Sbjct: 151 FPLVFRKVRPPSRKLKTTYKANKPNLFM 178

>sp|Q9ATF5|RL1X_CASSA 60S ribosomal protein L18a gi|13430184|gb|AAK25759.1|AF334839_1
           ribosomal protein L18a [Castanea sativa]
          Length = 178

 Score =  113 bits (282), Expect(2) = 3e-47
 Identities = 54/92 (58%), Positives = 70/92 (75%)
 Frame = +2

Query: 35  FKFHQYQVVGRHLPTAADANPTVYRMKVWAEDDVKAKSKFWYFLRKLRRVKKANGQIIAC 214
           F+FHQYQVVGR LP+  D +P +YRMK+WA ++V+AKSKFWYFLRKL++VKK+NGQ++A 
Sbjct: 4   FRFHQYQVVGRGLPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAI 63

Query: 215 NEIFERKPTLAKQLRASRVRYHVAHWCVHNMY 310
           NEIFE+ PT  K      +RY  +    HNMY
Sbjct: 64  NEIFEKNPTKIKNY-GIWLRYQ-SRTGYHNMY 93

 Score = 97.8 bits (242), Expect(2) = 3e-47
 Identities = 48/88 (54%), Positives = 62/88 (69%)
 Frame = +1

Query: 304 HVHRSTCDVTLNGSVSQMYQEMASRHRVRPSSIQIIKTATVDYHSCKRANTKQFHNEKIS 483
           ++++   D TLNG+V QMY EMASRHRVR   IQIIKTAT+    CKR ++KQFHN KI 
Sbjct: 91  NMYKEYRDTTLNGAVEQMYIEMASRHRVRFPCIQIIKTATIPAKLCKRESSKQFHNSKIK 150

Query: 484 FPVTQKLARPSSATFRTLFKANRPNVAM 567
           FP+  +  RP S   +T +KA+RPN+ M
Sbjct: 151 FPLVTRKIRPPSRKLKTHYKASRPNLFM 178

>ref|NP_188078.1| 60S ribosomal protein L18A (RPL18aC) [Arabidopsis thaliana]
           gi|21362875|sp|Q9LUD4|RL1Y_ARATH 60S ribosomal protein
           L18a-2 gi|9294382|dbj|BAB02392.1| 60S ribosomal protein
           L18A-like [Arabidopsis thaliana]
           gi|18176461|gb|AAL60048.1| AT3g14600/MIE1_10
           [Arabidopsis thaliana] gi|20453309|gb|AAM19893.1|
           AT3g14600/MIE1_10 [Arabidopsis thaliana]
          Length = 178

 Score =  112 bits (281), Expect(2) = 4e-47
 Identities = 54/94 (57%), Positives = 69/94 (72%)
 Frame = +2

Query: 29  GNFKFHQYQVVGRHLPTAADANPTVYRMKVWAEDDVKAKSKFWYFLRKLRRVKKANGQII 208
           G F+FHQYQVVGR LPT  D +P +YRMK+W  ++V AKSKFWYF+RKL++VKK+NGQ++
Sbjct: 2   GGFRFHQYQVVGRALPTENDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQML 61

Query: 209 ACNEIFERKPTLAKQLRASRVRYHVAHWCVHNMY 310
           A NEIFE+ PT  K      +RY  +    HNMY
Sbjct: 62  AINEIFEKNPTTIKNY-GIWLRYQ-SRTGYHNMY 93

 Score = 97.8 bits (242), Expect(2) = 4e-47
 Identities = 49/88 (55%), Positives = 60/88 (67%)
 Frame = +1

Query: 304 HVHRSTCDVTLNGSVSQMYQEMASRHRVRPSSIQIIKTATVDYHSCKRANTKQFHNEKIS 483
           ++++   D TLNG V QMY EMASRHRVR   IQIIKTATV    CKR  TKQFHN KI 
Sbjct: 91  NMYKEYRDTTLNGGVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKREITKQFHNSKIK 150

Query: 484 FPVTQKLARPSSATFRTLFKANRPNVAM 567
           FP+  +  RP S   +T +KA++PN+ M
Sbjct: 151 FPLVFRKVRPPSRKLKTTYKASKPNLFM 178

>gb|AAM65890.1| putative 60S ribosomal protein L18A [Arabidopsis thaliana]
          Length = 178

 Score =  112 bits (281), Expect(2) = 1e-46
 Identities = 54/94 (57%), Positives = 69/94 (72%)
 Frame = +2

Query: 29  GNFKFHQYQVVGRHLPTAADANPTVYRMKVWAEDDVKAKSKFWYFLRKLRRVKKANGQII 208
           G F+FHQYQVVGR LPT  D +P +YRMK+W  ++V AKSKFWYF+RKL++VKK+NGQ++
Sbjct: 2   GGFRFHQYQVVGRALPTENDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQML 61

Query: 209 ACNEIFERKPTLAKQLRASRVRYHVAHWCVHNMY 310
           A NEIFE+ PT  K      +RY  +    HNMY
Sbjct: 62  AINEIFEKNPTTIKNY-GIWLRYQ-SRTGYHNMY 93

 Score = 96.3 bits (238), Expect(2) = 1e-46
 Identities = 48/88 (54%), Positives = 60/88 (67%)
 Frame = +1

Query: 304 HVHRSTCDVTLNGSVSQMYQEMASRHRVRPSSIQIIKTATVDYHSCKRANTKQFHNEKIS 483
           ++++   D TLNG V QMY E+ASRHRVR   IQIIKTATV    CKR  TKQFHN KI 
Sbjct: 91  NMYKEYRDTTLNGGVEQMYTEIASRHRVRFPCIQIIKTATVPAKLCKREITKQFHNSKIK 150

Query: 484 FPVTQKLARPSSATFRTLFKANRPNVAM 567
           FP+  +  RP S   +T +KA++PN+ M
Sbjct: 151 FPLVFRKVRPPSRKLKTTYKASKPNLFM 178



EST assemble image


clone accession position
1 CM058d09_r AV390403 122 864
2 CM056g12_r AV390312 121 837
3 CM072g01_r AV391482 122 831
4 CM078a09_r AV391820 119 830
5 CM022g03_r AV387898 109 816
6 CM067e06_r AV390935 109 807
7 CM026g08_r AV387517 119 799
8 CM026d05_r AV387548 109 797
9 CM022f04_r AV387895 109 797
10 CM053b01_r AV389928 122 775
11 CM041b05_r AV389454 109 766
12 CM087g08_r AV392430 78 755
13 CM051e09_r AV389838 139 753
14 CM082a01_r AV392089 114 750
15 CM072f06_r AV391469 113 710
16 HC069a11_r AV637127 123 708
17 LCL056d04_r AV629313 109 702
18 LC055b03_r AV622823 120 694
19 CM092a01_r AV392647 314 692
20 CL63b03_r AV396518 109 687
21 HC099f08_r AV639460 109 687
22 LC012f04_r AV619750 109 685
23 LC073g07_r AV624162 109 683
24 HC009h02_r AV632574 116 683
25 HC046c11_r AV635435 120 658
26 HC058d06_r AV636351 110 656
27 HC096g03_r AV639238 125 655
28 LCL024d12_r AV627289 113 654
29 HC035e11_r AV634611 109 653
30 LC067g09_r AV623725 25 650
31 CM010d01_r AV387026 97 645
32 LC075d11_r AV387026 114 644
33 CM033b03_r AV388383 122 643
34 CM040e04_r AV389207 109 643
35 LCL050e10_r AV629025 110 641
36 LC100h03_r AV625996 111 640
37 MX008f02_r BP086426 130 639
38 CM012d09_r AV387145 113 638
39 LC081a06_r AV624670 112 634
40 CM033h06_r AV388436 109 633
41 HC092e03_r AV638911 124 628
42 HC007a03_r AV632344 67 624
43 MX104b02_r BP089039 109 619
44 LC012d04_r AV619735 114 618
45 LC003e06_r AV619081 123 617
46 LC033b06_r AV621233 117 617
47 LC067d10_r AV623698 115 616
48 MX202f08_r BP089197 121 614
49 CM051h10_r AV389847 107 614
50 HCL032e08_r AV641375 117 604
51 CM056g04_r AV390300 14 603
52 LCL098d10_r AV631701 121 600
53 CM004f11_r AV386683 103 587
54 MX060f06_r BP088443 113 582
55 MX055c09_r BP088249 110 582
56 MX041f05_r BP087692 111 579
57 HC080e09_r AV638006 118 572
58 LC039c01_r AV621658 110 564
59 MX026h09_r BP087158 111 553
60 HC065a10_r AV636849 1 547
61 LC100e09_r AV625973 136 541
62 LC064d01_r AV625973 117 540
63 MX067f09_r BP088738 109 536
64 HC056d05_r AV636198 121 532
65 CM038e08_r AV389052 122 532
66 CM008e09_r AV386729 120 530
67 MXL010d03_r BP093573 109 527
68 CM054e12_r AV390034 122 449
69 HC020f05_r AV633423 129 439
70 CM051f05_r AV389811 121 411
71 CM047a11_r AV388559 121 339
72 CM049f04_r AV389587 109 323
73 CM042f06_r AV389261 109 277
74 LCL024e07_r AV627294 111 241




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research