KCC000045A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000045A_C01 KCC000045A_c01
agttggatcagggatTTTACATTTGCTAGACACTAGGAGCAAGAACTATGCAGCTTAACG
CGGCGCCCAGGGAGGCGCTTGTCGCTCGCGGGAGCGGACGCCGTGTGCTTGTCGCCGCTC
AGCGCATCGGTGGCCGCACCCGCAAGGCCGTCCAGTGCCATGCAGCCCTCTCGTCCGGCT
TCCTCGGCCAGCGCGTGGCTGGTCGCATGGCTGTCGCGCCGGCCGCCCGCAAGGCTGGCC
GTGCCGGCCGGTTGGTGGTGAAGAGCATGTTCGAGCGCTTCACGGAGAAGGCCATCAAGG
TGGTCATGCTTGCTCAGGAGGAGGCTCGACCGGCTGGGACACAACTTCGTGGGCACGGAG
CAGCTGCTGCTGGGCCTCATCGGCGAGTCCACCGGCATTGACGCCAAGGTGCTGAAGAGC
ATGGGCGTGAACCTGAAGGACGCTCGTGTGGAGGTGGAGAAGATCATCGGCCGCGGCTCT
GGCTTTGTGGCGGTGGAAATCCCCTTCACTCCTC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000045A_C01 KCC000045A_c01
         (514 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_566912.1| ATP-dependent Clp protease ATP-binding subunit ...   114  8e-35
pir||T52456 endopeptidase Clp ATP-binding chain C [imported] - A...   114  8e-35
gb|AAL10478.1| AT3g48870/T21J18_140 [Arabidopsis thaliana]            114  8e-35
sp|P35100|CLPA_PEA ATP-dependent clp protease ATP-binding subuni...   117  9e-26
ref|NP_050661.1| Clp protease ATP binding subunit [Guillardia th...   116  2e-25

>ref|NP_566912.1| ATP-dependent Clp protease ATP-binding subunit (ClpC2) [Arabidopsis
           thaliana] gi|11265212|pir||T49283 AtClpC - Arabidopsis
           thaliana gi|7576225|emb|CAB87915.1| AtClpC [Arabidopsis
           thaliana]
          Length = 952

 Score =  114 bits (285), Expect(2) = 8e-35
 Identities = 56/61 (91%), Positives = 59/61 (95%)
 Frame = +1

Query: 331 RLGHNFVGTEQLLLGLIGESTGIDAKVLKSMGVNLKDARVEVEKIIGRGSGFVAVEIPFT 510
           RLGHNFVGTEQ+LLGLIGE TGI AKVLKSMG+NLKD+RVEVEKIIGRGSGFVAVEIPFT
Sbjct: 135 RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVEVEKIIGRGSGFVAVEIPFT 194

Query: 511 P 513
           P
Sbjct: 195 P 195

 Score = 54.3 bits (129), Expect(2) = 8e-35
 Identities = 31/60 (51%), Positives = 39/60 (64%), Gaps = 2/60 (3%)
 Frame = +3

Query: 180 FLGQRVAGRMAVAPAARKAGR--AGRLVVKSMFERFTEKAIKVVMLAQEEARPAGTQLRG 353
           +LG+   G +     A+ +GR  A R V K+MFERFTEKAIKV+ML+QEEAR  G    G
Sbjct: 83  YLGRPSPGFLVKYKLAKSSGREKASRCVPKAMFERFTEKAIKVIMLSQEEARRLGHNFVG 142

 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 21/54 (38%), Positives = 38/54 (69%)
 Frame = +1

Query: 331 RLGHNFVGTEQLLLGLIGESTGIDAKVLKSMGVNLKDARVEVEKIIGRGSGFVA 492
           +LGHN++G+E LLLGL+ E  G+ A+VL+++G +  + R +V +++G  +   A
Sbjct: 210 QLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA 263

>pir||T52456 endopeptidase Clp ATP-binding chain C [imported] - Arabidopsis
           thaliana gi|5360574|dbj|BAA82062.1| AtClpC [Arabidopsis
           thaliana]
          Length = 952

 Score =  114 bits (285), Expect(2) = 8e-35
 Identities = 56/61 (91%), Positives = 59/61 (95%)
 Frame = +1

Query: 331 RLGHNFVGTEQLLLGLIGESTGIDAKVLKSMGVNLKDARVEVEKIIGRGSGFVAVEIPFT 510
           RLGHNFVGTEQ+LLGLIGE TGI AKVLKSMG+NLKD+RVEVEKIIGRGSGFVAVEIPFT
Sbjct: 135 RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVEVEKIIGRGSGFVAVEIPFT 194

Query: 511 P 513
           P
Sbjct: 195 P 195

 Score = 54.3 bits (129), Expect(2) = 8e-35
 Identities = 31/60 (51%), Positives = 39/60 (64%), Gaps = 2/60 (3%)
 Frame = +3

Query: 180 FLGQRVAGRMAVAPAARKAGR--AGRLVVKSMFERFTEKAIKVVMLAQEEARPAGTQLRG 353
           +LG+   G +     A+ +GR  A R V K+MFERFTEKAIKV+ML+QEEAR  G    G
Sbjct: 83  YLGRPSPGFLVKYKLAKSSGREKASRCVPKAMFERFTEKAIKVIMLSQEEARRLGHNFVG 142

 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 21/54 (38%), Positives = 38/54 (69%)
 Frame = +1

Query: 331 RLGHNFVGTEQLLLGLIGESTGIDAKVLKSMGVNLKDARVEVEKIIGRGSGFVA 492
           +LGHN++G+E LLLGL+ E  G+ A+VL+++G +  + R +V +++G  +   A
Sbjct: 210 QLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA 263

>gb|AAL10478.1| AT3g48870/T21J18_140 [Arabidopsis thaliana]
          Length = 558

 Score =  114 bits (285), Expect(2) = 8e-35
 Identities = 56/61 (91%), Positives = 59/61 (95%)
 Frame = +1

Query: 331 RLGHNFVGTEQLLLGLIGESTGIDAKVLKSMGVNLKDARVEVEKIIGRGSGFVAVEIPFT 510
           RLGHNFVGTEQ+LLGLIGE TGI AKVLKSMG+NLKD+RVEVEKIIGRGSGFVAVEIPFT
Sbjct: 135 RLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVEVEKIIGRGSGFVAVEIPFT 194

Query: 511 P 513
           P
Sbjct: 195 P 195

 Score = 54.3 bits (129), Expect(2) = 8e-35
 Identities = 31/60 (51%), Positives = 39/60 (64%), Gaps = 2/60 (3%)
 Frame = +3

Query: 180 FLGQRVAGRMAVAPAARKAGR--AGRLVVKSMFERFTEKAIKVVMLAQEEARPAGTQLRG 353
           +LG+   G +     A+ +GR  A R V K+MFERFTEKAIKV+ML+QEEAR  G    G
Sbjct: 83  YLGRPSPGFLVKYKLAKSSGREKASRCVPKAMFERFTEKAIKVIMLSQEEARRLGHNFVG 142

 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 21/54 (38%), Positives = 38/54 (69%)
 Frame = +1

Query: 331 RLGHNFVGTEQLLLGLIGESTGIDAKVLKSMGVNLKDARVEVEKIIGRGSGFVA 492
           +LGHN++G+E LLLGL+ E  G+ A+VL+++G +  + R +V +++G  +   A
Sbjct: 210 QLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA 263

>sp|P35100|CLPA_PEA ATP-dependent clp protease ATP-binding subunit clpA homolog,
           chloroplast precursor gi|419773|pir||S31164
           endopeptidase Clp (EC 3.4.21.-) ATP-binding chain,
           chloroplast [similarity] - garden pea
           gi|169128|gb|AAA33680.1| nuclear encoded precursor to
           chloroplast protein
          Length = 922

 Score =  117 bits (293), Expect = 9e-26
 Identities = 65/100 (65%), Positives = 72/100 (72%)
 Frame = +1

Query: 214 SRRPPARLAVPAGWW*RACSSASRRRPSRWSCLLRRRLDRLGHNFVGTEQLLLGLIGEST 393
           SRR  A+  +P     RA       +  +   L +    RLGHNFVGTEQ+LLGLIGE T
Sbjct: 78  SRRARAKRFIP-----RAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGT 132

Query: 394 GIDAKVLKSMGVNLKDARVEVEKIIGRGSGFVAVEIPFTP 513
           GI AKVLKSMG+NLKDARVEVEKIIGRGSGFVAVEIPFTP
Sbjct: 133 GIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTP 172

 Score = 51.2 bits (121), Expect = 8e-06
 Identities = 21/57 (36%), Positives = 39/57 (67%)
 Frame = +1

Query: 331 RLGHNFVGTEQLLLGLIGESTGIDAKVLKSMGVNLKDARVEVEKIIGRGSGFVAVEI 501
           +LGHN++G+E LLLGL+ E  G+ A+VL+++G +  + R +V +++G  +  V   +
Sbjct: 187 QLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPTNIRTQVIRMVGESADSVTATV 243

>ref|NP_050661.1| Clp protease ATP binding subunit [Guillardia theta]
           gi|5921798|sp|O78410|CLPC_GUITH ATP-dependent clp
           protease ATP-binding subunit clpA homolog
           gi|3602934|gb|AAC35595.1| Clp protease ATP binding
           subunit [Guillardia theta]
          Length = 819

 Score =  116 bits (290), Expect = 2e-25
 Identities = 59/68 (86%), Positives = 61/68 (88%)
 Frame = +1

Query: 310 LLRRRLDRLGHNFVGTEQLLLGLIGESTGIDAKVLKSMGVNLKDARVEVEKIIGRGSGFV 489
           L +    RLGHNFVGTEQ+LLGLIGE TGI AKVLKSMGVNLKDARVEVEKIIGRGSGFV
Sbjct: 15  LAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDARVEVEKIIGRGSGFV 74

Query: 490 AVEIPFTP 513
           AVEIPFTP
Sbjct: 75  AVEIPFTP 82

 Score = 52.4 bits (124), Expect = 3e-06
 Identities = 22/47 (46%), Positives = 36/47 (75%)
 Frame = +1

Query: 331 RLGHNFVGTEQLLLGLIGESTGIDAKVLKSMGVNLKDARVEVEKIIG 471
           +LGHN++GTE LLLGLI E  G+ A+VL+++ ++L   R +V +++G
Sbjct: 97  QLGHNYIGTEHLLLGLIREGEGVAARVLENLALDLTKVRTQVIRLLG 143

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 22/29 (75%), Positives = 23/29 (78%)
 Frame = +3

Query: 267 MFERFTEKAIKVVMLAQEEARPAGTQLRG 353
           MFERFTEKAIKV+MLAQEEAR  G    G
Sbjct: 1   MFERFTEKAIKVIMLAQEEARRLGHNFVG 29



EST assemble image


clone accession position
1 MXL004d01_r BP093160 1 271
2 CL02c12_r AV397626 16 457
3 MXL061a06_r BP096577 304 514




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research