KCC000044A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000044A_C02 KCC000044A_c02
GAGAGAGAGAGAGAGAGAGAGAGAGATCTGCTTAACAACACACTCTCTGCCTTAGTCCCA
CCAGCATCGGCCTACCGTCCTCGTCTCCTGGAGTTCGTCACACGACAGCAACAATGGCCT
TCGTCCTGCGCGCGCCGCTGCTGGCCAGCCCAACTTCCGCCCCCGGCGTGGAGGCCCGCC
GTGCTGACACCCGCGCTCGCGCTGCCTCGTCGGCTACCGGCCCCACCGTCCACTGGGCAA
TCCCCCGGCCCCTGGCACCCCCTCCGCCAGCGGCTTCCCCGATCTGGTGCGTGCCCCTCC
TACTCGTCTCTGCTGCCATGCCCGTCTACGGCTACAAGAAGCAGCTGAAGCTCATTGACG
AGGCTCGTGCCAGGCAGCGCGCCTCCAAGGTCGTGGCCGCTGCCACCGCCCCCGCCACCA
AGAAGTAAATGCTCGCGCCATCAATGGAGGTTCAATGCGTGGAGGCCGATGGAAAGAAAG
TGACCCGTCTTGACTACAAAGACCGCCTGCGCAGGCGCGGGCCTGACGCCGTGACTTCGC
AACTGGCTGACGTTTCCTGTCTATATGATGATTGAGTGGTTGGTGGTTCTGGTGAACCGA
AGTACTCCTTGCGTGCATGGGTGTGGCGGATCTGTCGCATAGATGGCTGTCCATACCGTG
TAGACTGCTGTGTACGGGCGTATATTGCGTCCTCGTGCGCGCGTTTGGGCGTAATAAGAT
ACTGTCACTGCGTTGCAGTGTGAAGGTGGGCAGGGTGATGCCGCCACGTGAAGGCAAACG
CATAGCGCGACAGCGGTGCATACAACGAGCACGAGTACCCACAGATATGTACACTAGTGC
GTTGTTGCCTTGAAGATGCCGTGGCTTGATGACATCACGAGCTAGTAGAGACCGGCAAAG
AAACATGTGTTGTGACTGGATGTTGCTCAGGTCCTGGGCCGTCCGGTCCAAGGTGCATTC
CTTGCCATGTAACACCAGTCAGAGAAAAAAACAAGAAnAAAACAAAACAACAAAACAAAA
AACAAAGAAAAAAAGAAAACAAAACAAC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000044A_C02 KCC000044A_c02
         (1048 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_226843.2| similar to Ribonuclease III (RNase III) (p241) ...    51  4e-05
dbj|BAC37260.1| unnamed protein product [Mus musculus] gi|263472...    49  1e-04
ref|XP_129193.1| similar to human MGC2574 protein [Mus musculus]...    48  3e-04
dbj|BAA95108.1| unnamed protein product [Mus musculus]                 48  3e-04
ref|XP_341606.1| similar to KIAA1311 protein [Rattus norvegicus]       47  4e-04

>ref|XP_226843.2| similar to Ribonuclease III (RNase III) (p241) [Rattus norvegicus]
          Length = 1484

 Score = 50.8 bits (120), Expect = 4e-05
 Identities = 39/140 (27%), Positives = 50/140 (34%), Gaps = 10/140 (7%)
 Frame = +1

Query: 58  PPASAYRPRLLEFVTRQQ----------QWPSSCARRCWPAQLPPPAWRPAVLTPALALP 207
           P A  YRP+ L  +  QQ            PSS           PP        P +A  
Sbjct: 20  PSAPTYRPQNLRLLHPQQPPAQYQYEPPSAPSSSFSNSQAPNFMPPRPDFVPYPPPVAPS 79

Query: 208 RRLPAPPSTGQSPGPWHPLRQRLPRSGACPSYSSLLPCPSTATRSS*SSLTRLVPGSAPP 387
            + P PP   + P P H +R   P     P     +PCP+    S         P   PP
Sbjct: 80  AQGPLPPCPVRPPYPNHQMRHPFPVPPCFPPMPPPMPCPNNPPVSGAPPGQGTFPFMVPP 139

Query: 388 RSWPLPPPPPPRSKCSRHQW 447
            S P PPPPP   +   +Q+
Sbjct: 140 PSMPHPPPPPVMPQQVNYQY 159

>dbj|BAC37260.1| unnamed protein product [Mus musculus] gi|26347267|dbj|BAC37282.1|
           unnamed protein product [Mus musculus]
          Length = 426

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 42/127 (33%), Positives = 54/127 (42%), Gaps = 3/127 (2%)
 Frame = +1

Query: 55  VPPASAYRPRLLEFVTRQQQWPSSCARRCWPAQLPPPAWRPAVLTPALALPRRLPAP-PS 231
           VP  S  +  L++F +  ++     + R  P  LP P  +P     +   P  LP+P P 
Sbjct: 24  VPEVSRAKRALVDFKSNSEETGELKSTRVPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQ 83

Query: 232 TGQSPG-PWHPLRQRLPRSGACPSYSSLLPCPSTATRSS*SSLTRLVPGS-APPRSWPLP 405
              SPG P+ PL   LP  G  P  S   PCP  +  S         PGS  PP S P P
Sbjct: 84  PETSPGSPFPPL--SLPSPGPQPETSPGSPCPPLSLPSP-GPQPETSPGSPCPPLSLPSP 140

Query: 406 PPPPPRS 426
            P P  S
Sbjct: 141 GPQPEAS 147

 Score = 41.6 bits (96), Expect = 0.023
 Identities = 32/96 (33%), Positives = 39/96 (40%), Gaps = 7/96 (7%)
 Frame = +1

Query: 121 SSCARRCWPAQLPPPAWRPAVLTPALALPRRLPAPPSTGQSPGP------WHPLRQRLPR 282
           S C     P+  P P   P    P L+LP   P P ++  SPGP        P RQ  P 
Sbjct: 110 SPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPEASPGSPGPRQDADDGSPQRQPEPH 169

Query: 283 SGACPSYSSL-LPCPSTATRSS*SSLTRLVPGSAPP 387
            G+   +  L L  P+  T SS  S  R  P   PP
Sbjct: 170 PGSLQPHQDLGLESPAGQTESSPESPQREQPSKLPP 205

>ref|XP_129193.1| similar to human MGC2574 protein [Mus musculus]
           gi|26353800|dbj|BAC40530.1| unnamed protein product [Mus
           musculus] gi|28175353|gb|AAH43326.1| 6720480F16Rik
           protein [Mus musculus]
          Length = 426

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 42/127 (33%), Positives = 53/127 (41%), Gaps = 3/127 (2%)
 Frame = +1

Query: 55  VPPASAYRPRLLEFVTRQQQWPSSCARRCWPAQLPPPAWRPAVLTPALALPRRLPAP-PS 231
           VP  S  +  L++F +  ++     + R  P  LP P  +P     +   P  LP+P P 
Sbjct: 24  VPEVSRAKRALVDFKSNSEETGELKSTRVPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQ 83

Query: 232 TGQSPG-PWHPLRQRLPRSGACPSYSSLLPCPSTATRSS*SSLTRLVPGS-APPRSWPLP 405
              SPG P  PL   LP  G  P  S   PCP  +  S         PGS  PP S P P
Sbjct: 84  PETSPGSPCPPL--SLPSPGPQPETSPGSPCPPLSLPSP-GPQPETSPGSPCPPLSLPSP 140

Query: 406 PPPPPRS 426
            P P  S
Sbjct: 141 GPQPEAS 147

 Score = 41.6 bits (96), Expect = 0.023
 Identities = 32/96 (33%), Positives = 39/96 (40%), Gaps = 7/96 (7%)
 Frame = +1

Query: 121 SSCARRCWPAQLPPPAWRPAVLTPALALPRRLPAPPSTGQSPGP------WHPLRQRLPR 282
           S C     P+  P P   P    P L+LP   P P ++  SPGP        P RQ  P 
Sbjct: 110 SPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPEASPGSPGPRQDADDGSPQRQPEPH 169

Query: 283 SGACPSYSSL-LPCPSTATRSS*SSLTRLVPGSAPP 387
            G+   +  L L  P+  T SS  S  R  P   PP
Sbjct: 170 PGSLQPHQDLGLESPAGQTESSPESPQREQPSKLPP 205

 Score = 37.4 bits (85), Expect = 0.43
 Identities = 36/113 (31%), Positives = 41/113 (35%), Gaps = 5/113 (4%)
 Frame = +1

Query: 121 SSCARRCWPAQLPPPAWRPAVLTPALALPRRLPAPPSTGQSPGPWHPLRQRLPRSGACPS 300
           S C     P+  P P   P    P L+LP   P P ++  SP P  PL   LP  G  P 
Sbjct: 70  SPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCP--PL--SLPSPGPQPE 125

Query: 301 YSSLLPCPSTATRSS*SSLTRLVPGSAPPR-----SWPLPPPPPPRSKCSRHQ 444
            S   PCP  +  S         PGS  PR       P   P P       HQ
Sbjct: 126 TSPGSPCPPLSLPSP-GPQPEASPGSPGPRQDADDGSPQRQPEPHPGSLQPHQ 177

>dbj|BAA95108.1| unnamed protein product [Mus musculus]
          Length = 426

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 42/127 (33%), Positives = 53/127 (41%), Gaps = 3/127 (2%)
 Frame = +1

Query: 55  VPPASAYRPRLLEFVTRQQQWPSSCARRCWPAQLPPPAWRPAVLTPALALPRRLPAP-PS 231
           VP  S  +  L++F +  ++     + R  P  LP P  +P     +   P  LP+P P 
Sbjct: 24  VPEVSRAKRALVDFKSNSEETGELKSTRVPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQ 83

Query: 232 TGQSPG-PWHPLRQRLPRSGACPSYSSLLPCPSTATRSS*SSLTRLVPGS-APPRSWPLP 405
              SPG P  PL   LP  G  P  S   PCP  +  S         PGS  PP S P P
Sbjct: 84  PETSPGSPCPPL--SLPSPGPQPETSPGSPCPPLSLPSP-GPQPETSPGSPCPPLSLPSP 140

Query: 406 PPPPPRS 426
            P P  S
Sbjct: 141 GPQPEAS 147

 Score = 41.6 bits (96), Expect = 0.023
 Identities = 32/96 (33%), Positives = 39/96 (40%), Gaps = 7/96 (7%)
 Frame = +1

Query: 121 SSCARRCWPAQLPPPAWRPAVLTPALALPRRLPAPPSTGQSPGP------WHPLRQRLPR 282
           S C     P+  P P   P    P L+LP   P P ++  SPGP        P RQ  P 
Sbjct: 110 SPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPEASPGSPGPRQDADDGSPQRQPEPH 169

Query: 283 SGACPSYSSL-LPCPSTATRSS*SSLTRLVPGSAPP 387
            G+   +  L L  P+  T SS  S  R  P   PP
Sbjct: 170 PGSLQPHQDLGLESPAGQTESSPESPQREQPSKLPP 205

 Score = 37.4 bits (85), Expect = 0.43
 Identities = 36/113 (31%), Positives = 41/113 (35%), Gaps = 5/113 (4%)
 Frame = +1

Query: 121 SSCARRCWPAQLPPPAWRPAVLTPALALPRRLPAPPSTGQSPGPWHPLRQRLPRSGACPS 300
           S C     P+  P P   P    P L+LP   P P ++  SP P  PL   LP  G  P 
Sbjct: 70  SPCPPLSLPSPGPQPETSPGSPCPPLSLPSPGPQPETSPGSPCP--PL--SLPSPGPQPE 125

Query: 301 YSSLLPCPSTATRSS*SSLTRLVPGSAPPR-----SWPLPPPPPPRSKCSRHQ 444
            S   PCP  +  S         PGS  PR       P   P P       HQ
Sbjct: 126 TSPGSPCPPLSLPSP-GPQPEASPGSPGPRQDADDGSPQRQPEPHPGSLQPHQ 177

>ref|XP_341606.1| similar to KIAA1311 protein [Rattus norvegicus]
          Length = 1060

 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 37/99 (37%), Positives = 44/99 (44%), Gaps = 8/99 (8%)
 Frame = +1

Query: 145 PAQLPPPAWRPAVLTPALALPRRLPAP---PSTGQSPGPWHPLRQRLPRSGACPSYSSLL 315
           P  LPPP   P +L P +  P   P P   P  G  PGP H +R  +P+    P  S +L
Sbjct: 320 PPGLPPPP-PPGMLMPPMPGPGPGPGPGPGPGPGPGPGPGHSMRLPVPQGHGQPPPSVVL 378

Query: 316 PCPSTATRSS*SSLTRLVPG-SAPPRSWP----LPPPPP 417
           P P      S    +R  PG SA P   P    LPPP P
Sbjct: 379 PIPRPPISQSSLINSRDQPGTSAVPNLAPVGARLPPPLP 417



EST assemble image


clone accession position
1 MX015a07_r BP086713 1 253
2 LC002h01_r AV619033 30 712
3 HC062g04_r AV636679 56 629
4 LCL082e12_r AV630678 128 588
5 HC093h12_r AV639022 130 584
6 CM033d05_r AV388406 131 726
7 MXL094e09_r BP098517 132 512
8 MXL001b09_r BP092943 132 585
9 MX213d12_r BP089759 132 398
10 HC020e02_r AV633408 132 536
11 CM050h07_r AV389768 133 518
12 HC055g09_r AV636148 134 460
13 HC096c07_r AV639202 135 574
14 HC014d12_r AV632926 136 339
15 CM041h05_r AV389457 137 728
16 HCL023e01_r AV640850 137 712
17 CM089c10_r AV392258 137 658
18 CL19h11_r AV394197 138 536
19 HC078a08_r AV637826 138 269
20 HC039d11_r AV634901 138 485
21 LC023d04_r AV620532 138 706
22 HC054a01_r AV636008 138 671
23 LC005h12_r AV619272 138 661
24 LC100d02_r AV625959 139 523
25 CM042b12_r AV389293 139 460
26 MX217b10_r BP089999 140 365
27 MX026d02_r BP087135 140 279
28 MX027c12_r BP087174 140 546
29 CL64a07_r AV396638 140 655
30 HCL045c09_r AV642085 140 624
31 CM018b03_r AV387273 140 766
32 CM097b06_r AV393229 140 439
33 MX053g02_r BP088191 143 524
34 CM039a10_r AV388976 143 745
35 CL69e01_r AV396811 143 712
36 MX252c05_r BP092301 145 438
37 MX055g12_r BP088269 149 616
38 CS001c07_r AV397961 150 714
39 CM001b07_r AV386479 159 743
40 HC095b06_r AV639113 160 616
41 LCL084e09_r AV630807 177 701
42 LC045b09_r AV622040 190 444
43 CM040e05_r AV389190 206 801
44 MXL088h04_r BP098182 442 881
45 CM077f12_r AV391797 555 1127
46 CL63h08_r AV396516 558 1047
47 CM019b11_r AV387335 615 1190
48 LC064e05_r AV623486 631 1127
49 CL43g06_r AV395527 637 1134
50 CL02c07_r AV397621 905 1216




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research