KCC000043A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000043A_C01 KCC000043A_c01
catgttttAGGGTTTACAAGAGCAATGCAAGTCCTGCATCCCAGGCGCCCAACACACGCG
CGCACTGCGCTGTGTGGGCCAAAGACAAAATTGGGTCTCTCCGCCGGACCACACCTTGCT
CGAATGTTCATGTTTCCTCCGTTTGCCAGCACCAACTAACACCTCTGCATTTTTATCCTC
TCGGACTGCTATATCACTGCAACTCTCTGGGGTCCGAGCTACGTGCCTACGTGCCTTTCC
AACCACCGTCGAGTTCAAGTCTGTGAATCCTCGCCTCCCCAAGCGCCTCCCCTGATCCTC
AGGGTACTCGGCGTGCTCTGCCGCCAAGTGTGCGGCCTACAACCGCCTCCTCCTCCGCCC
GTCGCGCCCACAATGGGCCGCATACCGCAAGCTCCACTGCAGGCGGCGGCCCCACCTCCA
AGGCCCCAACACCTTTCCTAGCCCGCATCACCGCTGACTCTCTTCCCAACCCAGCTCGAA
GCCTAACAGACAACAGCCTTGCTGCTTCACTCCTGCCGCCTCCATGTCCGCTCCCGCTGC
TGCAGCAGGCAATTACTTGGCGCCGGTGGCGGCGGCGACCTCGGCGGCGAAGTCGTTCGA
CTTCTTCTCCAGGCCCTCGCCGAGCTGGAACTTGACGAACCGGCGCACCGAGATCTTCTC
GCCGATGGCGGCGATGGACTCCTTGATGGCCTCCGCCACGGTCTTGGAGGGGTCGGTGAG
GAAGGGCTGGTCCAGCAGGCACATCTCGGTCGCGATCTTCTTCGCGCGGCCCTCAGCGAT
CTTGGCGCGGATGGCGTCGGGCTTGCCCTTGAGGTCATCGCGGGCCATCTCCAGCTGCTT
CTCGCGCTCGAACACCTCGGCCGGGATCTCGTCCGCCGACACGTACTGCACGTTCTGGCC
CGCCACAATGCCCATGGCAATGTAGTTTAccagctcgttgacttctccgaggccgccacg
aaatcggtctcgcagttcacctccagcagcacacccaggcggctgccgg


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000043A_C01 KCC000043A_c01
         (1009 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|ZP_00073139.1| COG0264: Translation elongation factor Ts [Tr...   139  1e-36
ref|NP_897184.1| putative elongation factor EF-Ts [Synechococcus...   131  2e-34
ref|NP_894416.1| putative Elongation factor Ts, EF-Ts [Prochloro...   131  4e-34
ref|NP_682477.1| elongation factor TS [Thermosynechococcus elong...   127  5e-34
ref|NP_924775.1| elongation factor TS [Gloeobacter violaceus] gi...   130  5e-34

>ref|ZP_00073139.1| COG0264: Translation elongation factor Ts [Trichodesmium erythraeum
           IMS101]
          Length = 219

 Score =  139 bits (350), Expect(2) = 1e-36
 Identities = 69/127 (54%), Positives = 90/127 (70%)
 Frame = -2

Query: 936 ELVNYIAMGIVAGQNVQYVSADEIPAEVFEREKQLEMARDDLKGKPDAIRAKIAEGRAKK 757
           ELV  +AM I A   V+YVS D+IP E  E EK +EM R+DL  KP+ IR KI +GR  K
Sbjct: 93  ELVKNVAMQIAACPQVEYVSVDDIPTEFVESEKSIEMGREDLSNKPENIREKIVQGRIGK 152

Query: 756 IATEMCLLDQPFLTDPSKTVAEAIKESIAAIGEKISVRRFVKFQLGEGLEKKSNDFAAEV 577
              E+ L+DQP++ D +KT+ E IKE+ A +GEK+ VRRF++F LGEGLEK+ ++FA EV
Sbjct: 153 RLKELTLMDQPYIRDQNKTIEELIKETSAQLGEKVQVRRFIRFVLGEGLEKQESNFAEEV 212

Query: 576 AAATGAK 556
           AA TG K
Sbjct: 213 AAQTGKK 219

 Score = 37.0 bits (84), Expect(2) = 1e-36
 Identities = 15/21 (71%), Positives = 19/21 (90%)
 Frame = -3

Query: 1007 GSRLGVLLEVNCETDFVAASE 945
            G R+GVL+EVNC+TDFVA +E
Sbjct: 69   GGRIGVLVEVNCQTDFVARNE 89

>ref|NP_897184.1| putative elongation factor EF-Ts [Synechococcus sp. WH 8102]
           gi|33632795|emb|CAE07606.1| putative elongation factor
           EF-Ts [Synechococcus sp. WH 8102]
          Length = 219

 Score =  131 bits (329), Expect(2) = 2e-34
 Identities = 63/126 (50%), Positives = 88/126 (69%)
 Frame = -2

Query: 936 ELVNYIAMGIVAGQNVQYVSADEIPAEVFEREKQLEMARDDLKGKPDAIRAKIAEGRAKK 757
           EL+  ++M + A  NV+YVS D+IP E+ EREK +EM RDDL GKP+ ++ KI EGR  K
Sbjct: 93  ELLRDVSMQVAACPNVEYVSTDDIPDEIREREKAIEMGRDDLDGKPEQMKVKIVEGRIGK 152

Query: 756 IATEMCLLDQPFLTDPSKTVAEAIKESIAAIGEKISVRRFVKFQLGEGLEKKSNDFAAEV 577
              E+ L++QPF+ D S TV E +K++   IGE + VRRF ++ LGEG+E + +DFAAEV
Sbjct: 153 RLKELALMEQPFIKDSSITVTELVKQTAGKIGENVQVRRFTRYTLGEGIEVEESDFAAEV 212

Query: 576 AAATGA 559
           A+   A
Sbjct: 213 ASMKAA 218

 Score = 37.7 bits (86), Expect(2) = 2e-34
 Identities = 15/21 (71%), Positives = 19/21 (90%)
 Frame = -3

Query: 1007 GSRLGVLLEVNCETDFVAASE 945
            GSR+GVL+E+NCETDFVA  +
Sbjct: 69   GSRVGVLIEINCETDFVARGD 89

>ref|NP_894416.1| putative Elongation factor Ts, EF-Ts [Prochlorococcus marinus str.
           MIT 9313] gi|33634772|emb|CAE20758.1| putative
           Elongation factor Ts, EF-Ts [Prochlorococcus marinus
           str. MIT 9313]
          Length = 218

 Score =  131 bits (330), Expect(2) = 4e-34
 Identities = 65/121 (53%), Positives = 84/121 (68%)
 Frame = -2

Query: 933 LVNYIAMGIVAGQNVQYVSADEIPAEVFEREKQLEMARDDLKGKPDAIRAKIAEGRAKKI 754
           L+  +AM + A  NV+YVS +EIP +V E+EK +EM RDDL GKP+ I+AKI EGR  K 
Sbjct: 94  LLKDVAMQVAACPNVEYVSTEEIPVDVVEKEKSIEMGRDDLSGKPEQIKAKIVEGRIGKR 153

Query: 753 ATEMCLLDQPFLTDPSKTVAEAIKESIAAIGEKISVRRFVKFQLGEGLEKKSNDFAAEVA 574
             E+ LL+QPF+ D S TVAE +K+    IGE I VRRF ++ LGEG+E    DFA EVA
Sbjct: 154 LKELVLLEQPFIRDSSMTVAELVKQVAGKIGENIKVRRFTRYTLGEGIEVDQTDFATEVA 213

Query: 573 A 571
           +
Sbjct: 214 S 214

 Score = 36.6 bits (83), Expect(2) = 4e-34
 Identities = 15/21 (71%), Positives = 19/21 (90%)
 Frame = -3

Query: 1007 GSRLGVLLEVNCETDFVAASE 945
            G+R+GVLLE+NCETDFVA  +
Sbjct: 69   GARVGVLLELNCETDFVARGD 89

>ref|NP_682477.1| elongation factor TS [Thermosynechococcus elongatus BP-1]
           gi|22295412|dbj|BAC09239.1| elongation factor TS
           [Thermosynechococcus elongatus BP-1]
          Length = 297

 Score =  127 bits (320), Expect(2) = 5e-34
 Identities = 68/135 (50%), Positives = 88/135 (64%)
 Frame = -2

Query: 933 LVNYIAMGIVAGQNVQYVSADEIPAEVFEREKQLEMARDDLKGKPDAIRAKIAEGRAKKI 754
           LV  IA  I A  NV++VS D+IPAE  E+E+Q+ +  D LKGKP  ++ KI  G+ +K 
Sbjct: 94  LVQDIAKQIAACPNVEFVSLDDIPAEYKEKERQIALGSDALKGKPPEVQEKIVAGKLEKT 153

Query: 753 ATEMCLLDQPFLTDPSKTVAEAIKESIAAIGEKISVRRFVKFQLGEGLEKKSNDFAAEVA 574
             E+CLL QPF+ D SKTV E +KE IA +GE I +RRF +F LGEG+EK+  + A EVA
Sbjct: 154 LKELCLLYQPFIRDQSKTVEELVKEHIAELGENIRIRRFQRFVLGEGIEKQETNLAEEVA 213

Query: 573 AATGAK*LPAAAAGA 529
           A T A    A  A A
Sbjct: 214 AQTQAMRAAAQTAAA 228

 Score = 40.0 bits (92), Expect(2) = 5e-34
 Identities = 17/22 (77%), Positives = 20/22 (90%)
 Frame = -3

Query: 1007 GSRLGVLLEVNCETDFVAASEK 942
            G R+GVL+EVNCETDFVA +EK
Sbjct: 69   GGRIGVLVEVNCETDFVARNEK 90

>ref|NP_924775.1| elongation factor TS [Gloeobacter violaceus]
           gi|35212395|dbj|BAC89770.1| elongation factor TS
           [Gloeobacter violaceus]
          Length = 219

 Score =  130 bits (328), Expect(2) = 5e-34
 Identities = 68/129 (52%), Positives = 89/129 (68%)
 Frame = -2

Query: 945 EVNELVNYIAMGIVAGQNVQYVSADEIPAEVFEREKQLEMARDDLKGKPDAIRAKIAEGR 766
           E  +LV  IAM I A  NV++VS D++  EV +RE  +E+ R+DL  KP+ IRA+IA+GR
Sbjct: 90  EFQQLVRDIAMQIAASPNVEFVSVDDVDQEVKDRELAIEVQREDLLSKPEKIRAQIAQGR 149

Query: 765 AKKIATEMCLLDQPFLTDPSKTVAEAIKESIAAIGEKISVRRFVKFQLGEGLEKKSNDFA 586
             K+  E  LL+QPF+ D S +V E I + IA IGE I VRRF +F LGEGLEK+  +FA
Sbjct: 150 VDKLFKERALLEQPFIKDQSISVGELITQKIAKIGENIKVRRFARFVLGEGLEKEEKNFA 209

Query: 585 AEVAAATGA 559
            EVAA TG+
Sbjct: 210 EEVAAQTGS 218

 Score = 37.0 bits (84), Expect(2) = 5e-34
 Identities = 15/22 (68%), Positives = 19/22 (86%)
 Frame = -3

Query: 1007 GSRLGVLLEVNCETDFVAASEK 942
            G R+GVL+EVNC+TDFVA  E+
Sbjct: 69   GGRIGVLVEVNCQTDFVAKGEE 90



EST assemble image


clone accession position
1 HCL067f06_r AV643327 1 441
2 MXL055a06_r BP096234 47 388
3 MXL033h01_r BP094985 246 634
4 CL02b12_r AV397625 493 1047




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research