KCC000042A_c03
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000042A_C03 KCC000042A_c03
cggcgcccgaaacggcgttggacgacgtggccgagtacagtgcgggggcgagcccacccg
aggcgccggcggagcgctggGCGCACACCGTGTACGAGGTGAAGTTCCGCACCAACCAGC
TTGAGCACGACTTCGGGCGGCCCTACCAGTTGGGGCACCACGCCGGCGCGGACACAGTGG
ACCACAAGTGCGAGCAGCCAAAATGGTTTCCTGCTCGCAGCAAGAAGATTGTGAAGGAGC
GGGGTCAGGAGCCCGATGAGTTCGAGGAGCAGGTGGCCCAGGCCCTGCTTCGAGCCTGGA
GGCTACCAACGCGGAGCTGAAGGCCGACCTGCGTGACCTCTACATCACCTCCGCCAAGGC
AGGTCGATGTCGCCAACGGCGCTCGCAAGGGCGATCATCATCCACGTGCCCTACCGCCTG
CTGAAGGCTTTCCACAAGATTCAGCAGCGCCTGGTGCGCGAGCTGGAGAAGAAGTTCAGC
GGCCGCGACGTGGTGATTGTCGGCAACCGCCGCATCCTGCCGCCCCCCCGCAACGGCAAG
ACCGCCTCGCGCCCCCGCAGCCGCACCCTGACCGCGGTGCACGACGCCATTCTGGACGAC
CTGGTGTACCCCACGGAGATCGTGGGCAAGCGCATCCGCTACCGGCTGGACGGCTCCAAG
ATCCTGAAGGTGCACCTGGACCCCAAGGACCGCAACTCCACCGAGTACAAGCTGGAGACC
TTCGGCAGCGTGTACAAGCGCCTCACAGGCAAGGACGTGAGCTTCGAGTTCCCGGTCGCC
GAGTCCTCGTAAAGCAAGAGAGTGTGCGGGCACTCCCTGTGCTAGTCTTGGTGTAACGTT
ATTCTCCGGGAACAAAAAAAAAAAAAAAAAc


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000042A_C03 KCC000042A_c03
         (871 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|Q9ZNS1|RS7_AVIMR 40S ribosomal protein S7 gi|3851636|gb|AAC97...   196  1e-54
gb|AAD26256.1|AF118149_1 ribosomal protein S7 [Secale cereale]        197  2e-54
gb|AAN04468.1| ribosomal protein S7 [Oryza sativa (japonica cult...   196  7e-54
ref|NP_175314.1| 40S ribosomal protein S7 (RPS7A) [Arabidopsis t...   195  2e-53
emb|CAC44242.1| Ribosomal protein S7 [Hordeum vulgare subsp. vul...   192  3e-53

>sp|Q9ZNS1|RS7_AVIMR 40S ribosomal protein S7 gi|3851636|gb|AAC97947.1| unknown
           [Avicennia marina] gi|4128206|gb|AAD03501.1| 40S
           ribosome protein S7 [Avicennia marina]
          Length = 190

 Score =  196 bits (499), Expect(3) = 1e-54
 Identities = 92/132 (69%), Positives = 111/132 (83%)
 Frame = +1

Query: 388 RAIIIHVPYRLLKAFHKIQQRLVRELEKKFSGRDVVIVGNRRILPPPRNGKTASRPRSRT 567
           +A++IHVPYRL K+F KI  RLVRELEKKFSG++VV++  RRIL PP+ G    RPRSRT
Sbjct: 59  KAVVIHVPYRLRKSFRKIHPRLVRELEKKFSGKEVVLIATRRILRPPKKGSAVQRPRSRT 118

Query: 568 LTAVHDAILDDLVYPTEIVGKRIRYRLDGSKILKVHLDPKDRNSTEYKLETFGSVYKRLT 747
           LTAVHDA+L+D+VYP EIVGKR+RYRLDGSKI+KV LDPK +N TE KLETF  VY++L+
Sbjct: 119 LTAVHDAMLEDIVYPAEIVGKRVRYRLDGSKIMKVFLDPKAKNDTENKLETFAGVYRKLS 178

Query: 748 GKDVSFEFPVAE 783
           GKDV FEFP+ E
Sbjct: 179 GKDVVFEFPLTE 190

 Score = 30.4 bits (67), Expect(3) = 1e-54
 Identities = 13/19 (68%), Positives = 16/19 (83%)
 Frame = +2

Query: 299 EATNAELKADLRDLYITSA 355
           E TN E+K+DL+DLYI SA
Sbjct: 31  ENTNQEIKSDLKDLYINSA 49

 Score = 30.4 bits (67), Expect(3) = 1e-54
 Identities = 14/22 (63%), Positives = 17/22 (76%)
 Frame = +3

Query: 222 KKIVKERGQEPDEFEEQVAQAL 287
           +KI K++  EP EFEE VAQAL
Sbjct: 6   QKIHKDKDAEPTEFEENVAQAL 27

>gb|AAD26256.1|AF118149_1 ribosomal protein S7 [Secale cereale]
          Length = 192

 Score =  197 bits (500), Expect(3) = 2e-54
 Identities = 92/134 (68%), Positives = 114/134 (84%)
 Frame = +1

Query: 388 RAIIIHVPYRLLKAFHKIQQRLVRELEKKFSGRDVVIVGNRRILPPPRNGKTASRPRSRT 567
           +A++IHVPYRL K F KI  RLVRELEKKFSG+DVVIV  RRI+ PP+ G    RPR+RT
Sbjct: 59  KAVVIHVPYRLRKNFRKIHVRLVRELEKKFSGKDVVIVATRRIVRPPKKGSAVVRPRTRT 118

Query: 568 LTAVHDAILDDLVYPTEIVGKRIRYRLDGSKILKVHLDPKDRNSTEYKLETFGSVYKRLT 747
           LTAVHD +L+D+VYP EIVGKR+RYRLDGSKI+K+ LDP +RN+TEYKL+TF +VY+RL 
Sbjct: 119 LTAVHDGLLEDVVYPAEIVGKRVRYRLDGSKIIKIFLDPMERNNTEYKLDTFTAVYRRLC 178

Query: 748 GKDVSFEFPVAESS 789
           GKDV +E+PVAE++
Sbjct: 179 GKDVVYEYPVAETA 192

 Score = 32.0 bits (71), Expect(3) = 2e-54
 Identities = 14/21 (66%), Positives = 17/21 (80%)
 Frame = +3

Query: 222 KKIVKERGQEPDEFEEQVAQA 284
           KKI K++G EP EFE+ VAQA
Sbjct: 6   KKIQKDKGLEPSEFEDTVAQA 26

 Score = 27.7 bits (60), Expect(3) = 2e-54
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = +2

Query: 296 LEATNAELKADLRDLYITSA 355
           LE  N ELK+D++DLYI +A
Sbjct: 30  LENGNQELKSDVKDLYINAA 49

>gb|AAN04468.1| ribosomal protein S7 [Oryza sativa (japonica cultivar-group)]
          Length = 192

 Score =  196 bits (497), Expect(3) = 7e-54
 Identities = 91/134 (67%), Positives = 113/134 (83%)
 Frame = +1

Query: 388 RAIIIHVPYRLLKAFHKIQQRLVRELEKKFSGRDVVIVGNRRILPPPRNGKTASRPRSRT 567
           +A+IIHVPYRL KA+ KI  RLVRELEKKFSG+DVV+V  RRI+ PP+ G    RPR+RT
Sbjct: 59  KAVIIHVPYRLRKAYKKIHVRLVRELEKKFSGKDVVLVATRRIVRPPKKGSAVVRPRTRT 118

Query: 568 LTAVHDAILDDLVYPTEIVGKRIRYRLDGSKILKVHLDPKDRNSTEYKLETFGSVYKRLT 747
           LTAVHD IL+D+VYP EIVGKR+RY LDG KI+K+ LDPK+RN+TEYKL+TF SVY+RL 
Sbjct: 119 LTAVHDGILEDVVYPAEIVGKRVRYHLDGRKIMKIFLDPKERNNTEYKLDTFSSVYRRLC 178

Query: 748 GKDVSFEFPVAESS 789
           GKDV F++P+ E++
Sbjct: 179 GKDVVFDYPMTETA 192

 Score = 30.4 bits (67), Expect(3) = 7e-54
 Identities = 13/21 (61%), Positives = 17/21 (80%)
 Frame = +3

Query: 222 KKIVKERGQEPDEFEEQVAQA 284
           +KI K++G EP EFE+ VAQA
Sbjct: 6   RKIQKDKGLEPTEFEDTVAQA 26

 Score = 28.5 bits (62), Expect(3) = 7e-54
 Identities = 13/20 (65%), Positives = 15/20 (75%)
 Frame = +2

Query: 296 LEATNAELKADLRDLYITSA 355
           LE  N ELK+DL+DLYI  A
Sbjct: 30  LENGNQELKSDLKDLYINGA 49

>ref|NP_175314.1| 40S ribosomal protein S7 (RPS7A) [Arabidopsis thaliana]
           gi|30694420|ref|NP_849786.1| 40S ribosomal protein S7
           (RPS7A) [Arabidopsis thaliana] gi|25294579|pir||A96526
           probable 40S ribosomal protein S7 homolog, [imported] -
           Arabidopsis thaliana
           gi|12321110|gb|AAG50658.1|AC084242_2 40S ribosomal
           protein S7 homolog, putative [Arabidopsis thaliana]
           gi|12597817|gb|AAG60128.1|AC073555_12 40S ribosomal
           protein S7 homolog, putative [Arabidopsis thaliana]
           gi|15724216|gb|AAL06501.1|AF412048_1 At1g48830/T24P22_5
           [Arabidopsis thaliana] gi|18252255|gb|AAL62008.1|
           At1g48830/T24P22_5 [Arabidopsis thaliana]
           gi|21555683|gb|AAM63913.1| 40S ribosomal protein S7
           homolog, putative [Arabidopsis thaliana]
          Length = 191

 Score =  195 bits (496), Expect(3) = 2e-53
 Identities = 90/133 (67%), Positives = 114/133 (85%)
 Frame = +1

Query: 388 RAIIIHVPYRLLKAFHKIQQRLVRELEKKFSGRDVVIVGNRRILPPPRNGKTASRPRSRT 567
           +AI+++VPYRL KA+ KI  RLVRELEKKFSG+DV+++  RRI+ PP+ G  A RPR+RT
Sbjct: 59  KAIVVNVPYRLRKAYRKIHVRLVRELEKKFSGKDVILIATRRIVRPPKKGSAAKRPRNRT 118

Query: 568 LTAVHDAILDDLVYPTEIVGKRIRYRLDGSKILKVHLDPKDRNSTEYKLETFGSVYKRLT 747
           LT+VH+AILDD+V P EIVGKR RYRLDG+KI+KV LDPK+RN+TEYK+E F +VYK+LT
Sbjct: 119 LTSVHEAILDDVVLPAEIVGKRTRYRLDGTKIMKVFLDPKERNNTEYKVEAFSAVYKKLT 178

Query: 748 GKDVSFEFPVAES 786
           GKDV FEFP+ E+
Sbjct: 179 GKDVVFEFPITEA 191

 Score = 30.8 bits (68), Expect(3) = 2e-53
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = +2

Query: 296 LEATNAELKADLRDLYITSA 355
           LE TN ELK++L+DLY+ SA
Sbjct: 30  LENTNQELKSELKDLYVNSA 49

 Score = 26.9 bits (58), Expect(3) = 2e-53
 Identities = 13/20 (65%), Positives = 15/20 (75%)
 Frame = +3

Query: 225 KIVKERGQEPDEFEEQVAQA 284
           KI KE+G E  E +EQVAQA
Sbjct: 7   KIHKEKGVELSELDEQVAQA 26

>emb|CAC44242.1| Ribosomal protein S7 [Hordeum vulgare subsp. vulgare]
          Length = 191

 Score =  192 bits (487), Expect(3) = 3e-53
 Identities = 90/134 (67%), Positives = 113/134 (84%)
 Frame = +1

Query: 388 RAIIIHVPYRLLKAFHKIQQRLVRELEKKFSGRDVVIVGNRRILPPPRNGKTASRPRSRT 567
           +A++IHVPYRL K F KI  RLVRELE+  SG+DVV V  RRI+ PP+ G    RPR+RT
Sbjct: 59  KAVVIHVPYRLRKPFRKIHVRLVRELER-VSGKDVVFVATRRIVRPPKKGSAVQRPRTRT 117

Query: 568 LTAVHDAILDDLVYPTEIVGKRIRYRLDGSKILKVHLDPKDRNSTEYKLETFGSVYKRLT 747
           LTAVHD IL+D+VYP EIVGKR+RYRLDG+K++K++LDPK+RN+TEYKLETF +VY+RL 
Sbjct: 118 LTAVHDGILEDVVYPAEIVGKRVRYRLDGAKVIKIYLDPKERNNTEYKLETFSAVYRRLC 177

Query: 748 GKDVSFEFPVAESS 789
           GKDV FE+PVAE++
Sbjct: 178 GKDVVFEYPVAETA 191

 Score = 32.0 bits (71), Expect(3) = 3e-53
 Identities = 14/21 (66%), Positives = 17/21 (80%)
 Frame = +3

Query: 222 KKIVKERGQEPDEFEEQVAQA 284
           KKI K++G EP EFE+ VAQA
Sbjct: 6   KKIQKDKGVEPSEFEDTVAQA 26

 Score = 28.9 bits (63), Expect(3) = 3e-53
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = +2

Query: 296 LEATNAELKADLRDLYITSA 355
           LE  N ELK+DL+DLYI +A
Sbjct: 30  LENGNQELKSDLKDLYINTA 49



EST assemble image


clone accession position
1 LC049e01_r AV622420 1 527
2 HC021f12_r AV633516 79 729
3 MX211g11_r BP089670 81 360
4 MX005g07_r BP086284 81 579
5 MX065c06_r BP088627 166 582
6 LC024c10_r AV620607 167 519
7 LC007h03_r AV619400 169 763
8 MXL022h04_r BP094425 172 687
9 LCL034g12_r AV627979 172 419
10 MXL093e02_r BP098448 172 609
11 HC006b02_r AV632271 172 728
12 MXL097d02_r BP098684 172 596
13 LC008e02_r AV619447 173 694
14 LC043g04_r AV622002 173 744
15 LC093g11_r AV625504 173 682
16 LC055c11_r AV622838 173 760
17 LC006c01_r AV619291 173 741
18 LC096g08_r AV625712 173 584
19 LCL086h09_r AV630963 173 677
20 LCL046g09_r AV628770 173 652
21 LC068b01_r AV623745 173 710
22 LC023h11_r AV620579 173 784
23 MX224f09_r BP090487 173 517
24 MX058b11_r BP088342 174 699
25 LC046a12_r AV622171 174 716
26 MXL003b12_r BP093088 174 640
27 MX024a04_r BP087054 174 634
28 MXL029f07_r BP094785 174 650
29 MXL003d06_r BP093102 175 551
30 MXL016b11_r BP093954 176 768
31 MXL070f07_r BP097133 176 611
32 HC038f02_r AV634836 177 770
33 MXL084b07_r BP097959 177 613
34 MXL015c02_r BP093892 177 432
35 MXL004h10_r BP093202 177 697
36 CM008e10_r AV386737 177 698
37 CM017f02_r AV388185 179 846
38 HCL024h05_r AV640930 179 643
39 CM004b06_r AV386661 179 776
40 MXL045b04_r BP095644 179 648
41 LC031b12_r AV621099 180 762
42 CS001a10_r AV398021 181 787
43 HC029h06_r AV634152 181 790
44 MX242f09_r BP091684 181 804
45 HC023a08_r AV633618 181 613
46 HCL026a08_r AV641004 181 668
47 HC021h08_r AV633534 181 692
48 LC089e04_r AV625222 182 664
49 LC046d12_r AV622198 182 725
50 LC033h04_r AV621285 182 732
51 LC079b01_r AV624534 182 689
52 LC061e09_r AV623285 182 728
53 MX065f04_r BP088640 182 723
54 MX201e11_r BP089144 183 579
55 MX013d02_r BP086634 183 458
56 HCL018a06_r AV640540 183 552
57 HC080c12_r AV637990 183 731
58 HC015f06_r AV633015 183 681
59 CM094a03_r AV393265 183 772
60 HCL075e09_r AV643762 183 770
61 HCL030g06_r AV641266 183 762
62 MXL077c09_r BP097525 183 706
63 MX223h04_r BP090435 183 542
64 MXL061b06_r BP096581 183 615
65 MXL026d10_r BP094651 183 547
66 MX044d10_r BP087826 183 586
67 MXL076f10_r BP097493 183 629
68 MX001e01_r BP086078 183 728
69 MXL047c03_r BP095776 183 631
70 CS001e08_r AV397948 183 793
71 HC052a04_r AV635866 183 687
72 LCL046e07_r AV628745 184 698
73 MXL081b03_r BP097772 185 625
74 CM034d08_r AV388665 185 724
75 MXL014h01_r BP093861 185 772
76 CL56f10_r AV396128 185 636
77 MXL058b05_r BP096399 185 706
78 MX037d04_r BP087557 186 670
79 HC098e03_r AV639369 186 651
80 MXL100h02_r BP098887 189 621
81 LC057h11_r AV623026 189 787
82 CL76b03_r AV397108 192 787
83 HC079d06_r AV637922 192 675
84 CL68a07_r AV396916 201 906
85 LC059c02_r AV623122 211 763
86 HC005f01_r AV632232 211 789
87 MXL024d08_r BP094523 213 588
88 LCL069h07_r AV629954 231 688
89 MX019g02_r BP086895 232 762
90 MXL042a02_r BP095448 239 694
91 MXL040a03_r BP095327 246 581
92 MX009f03_r BP086472 259 788
93 MXL077f07_r BP097553 276 805
94 MX028d02_r BP087223 279 691
95 CL60g04_r AV396397 279 867
96 CL36f07_r AV395145 291 869
97 CL24c01_r AV394405 312 806
98 CL61e03_r AV396304 313 887
99 CL22h09_r AV394271 315 863
100 CL38b06_r AV395299 321 840
101 CL46f11_r AV395637 321 633
102 CL71g01_r AV396902 340 905
103 CL02e02_r AV397584 343 911
104 CL57a10_r AV396264 355 927
105 CL22g01_r AV394240 361 905
106 LC007a07_r AV619346 374 917
107 CL12d06_r AV393818 390 905
108 CL74c11_r AV396463 392 838
109 CL15a03_r AV393952 406 912
110 CL34b08_r AV394923 418 905
111 CS001g05_r AV398014 423 899
112 CS001h02_r AV397985 425 904
113 HC040e04_r AV634988 453 912
114 MX257c07_r BP092651 645 965




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research