KCC000041A_c03
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000041A_C03 KCC000041A_c03
CAGATCAAAATGGGCAAGGTCCACGGGTTCCCTCGCCCGTGCCGGTAAGGTGCGCGGCCA
GACCCCCAAGGGTCCCCAAGCAGGAGAAGAAGAAGCGCCCGCGGGGCCGTGCCATGAAGC
GCATGAAGTACAACCGCCGCTTCGTCAACGTCGTGGTGGGCTTCGGCAAGAAGCGCGGTC
CCAACTCCAACCCCGCCTAAGCGGACGCGGCCAGTTGTAGAGGCGACACTCTGGCGTATC
GGCGTGGCAGCTATGGGCTCTACAGGACTTATTAGCGCCTTGTCGTGGAGTTCAGAGTAG
CCCTGCAGCCGCTGCATCGGCGGCGGTTCTGGCCTCGCGGGGCGCACAGCAGAGCAGGAG
CGGCGTAGCATTTGGAGATTGCGGGGAGCGACAAGCAGGAGCTTTAGTCGTGGTGAAGAG
GGCCTGACAGTTCTGGAGGCTCGGATGTCGGAGCCCAACCTCGCTGGTGGGTGCCGCGAG
GCCCCGCAGCGCAGACAGTGGACCAGGTTCCTATGGTATCCGTTGGCTGTAACGGCAGTT
GCGTGAAAAAAAAAAAAAAAAAAAAAACTCGGGGGGGGCCGGTCCCATCGCCTTATGGAT
GATAGGCGCCCGGCGCGTTTTAAGGCGGGTGGGAACCGGG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000041A_C03 KCC000041A_c03
         (640 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAC86461.1| putative 40S ribosomal protein S30 [Polytomella ...    71  1e-11
ref|NP_194668.1| 40S ribosomal protein S30 (RPS30B) [Arabidopsis...    71  2e-11
pir||F84580 40S ribosomal protein S30 [imported] - Arabidopsis t...    71  2e-11
sp|Q05472|RS30_HUMAN 40S ribosomal protein S30 gi|1334234|emb|CA...    67  2e-10
ref|XP_345683.1| similar to fusion protein [Rattus norvegicus]         67  2e-10

>emb|CAC86461.1| putative 40S ribosomal protein S30 [Polytomella sp. Pringsheim
           198.80]
          Length = 61

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 33/42 (78%), Positives = 37/42 (87%)
 Frame = +3

Query: 66  PRVPKQEKKKRPRGRAMKRMKYNRRFVNVVVGFGKKRGPNSN 191
           P+V KQEKKKRP GRA+KR+KY RRFVNVV G GKK+GPNSN
Sbjct: 19  PKVAKQEKKKRPVGRALKRVKYIRRFVNVVSGIGKKKGPNSN 60

 Score = 37.0 bits (84), Expect = 0.24
 Identities = 17/27 (62%), Positives = 21/27 (76%)
 Frame = +2

Query: 26  GSLARAGKVRGQTPKGPQAGEEEAPAG 106
           GSLARAGKVRGQTPK  +  +++ P G
Sbjct: 6   GSLARAGKVRGQTPKVAKQEKKKRPVG 32

>ref|NP_194668.1| 40S ribosomal protein S30 (RPS30B) [Arabidopsis thaliana]
           gi|15241895|ref|NP_200478.1| 40S ribosomal protein S30
           (RPS30C) [Arabidopsis thaliana]
           gi|18399137|ref|NP_565458.1| 40S ribosomal protein S30
           (RPS30A) [Arabidopsis thaliana]
           gi|22096379|sp|P49689|RS30_ARATH 40S ribosomal protein
           S30 gi|25407611|pir||H85342 RIBOSOMAL PROTEIN S30
           homolog [imported] - Arabidopsis thaliana
           gi|7269837|emb|CAB79697.1| RIBOSOMAL PROTEIN S30 homolog
           [Arabidopsis thaliana] gi|10176771|dbj|BAB09885.1| 40S
           ribosomal protein S30 homolog [Arabidopsis thaliana]
           gi|15450480|gb|AAK96533.1| At2g19750/F6F22.22
           [Arabidopsis thaliana] gi|16974467|gb|AAL31237.1|
           At2g19750/F6F22.22 [Arabidopsis thaliana]
           gi|20197294|gb|AAC62141.2| 40S ribosomal protein S30
           [Arabidopsis thaliana] gi|21618031|gb|AAM67081.1| 40S
           ribosomal protein S30 [Arabidopsis thaliana]
           gi|22135964|gb|AAM91564.1| 40S ribosomal protein
           S30-like protein [Arabidopsis thaliana]
           gi|30102786|gb|AAP21311.1| At5g56670 [Arabidopsis
           thaliana]
          Length = 62

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 31/42 (73%), Positives = 38/42 (89%)
 Frame = +3

Query: 66  PRVPKQEKKKRPRGRAMKRMKYNRRFVNVVVGFGKKRGPNSN 191
           P+V KQ+KKK+PRGRA KR+++NRRFV  VVGFGKKRGPNS+
Sbjct: 19  PKVAKQDKKKKPRGRAHKRLQHNRRFVTAVVGFGKKRGPNSS 60

 Score = 39.7 bits (91), Expect = 0.037
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +2

Query: 26  GSLARAGKVRGQTPKGPQAGEEEAPAGPCHE 118
           GSLARAGKVRGQTPK  +  +++ P G  H+
Sbjct: 6   GSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 36

>pir||F84580 40S ribosomal protein S30 [imported] - Arabidopsis thaliana
          Length = 68

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 31/42 (73%), Positives = 38/42 (89%)
 Frame = +3

Query: 66  PRVPKQEKKKRPRGRAMKRMKYNRRFVNVVVGFGKKRGPNSN 191
           P+V KQ+KKK+PRGRA KR+++NRRFV  VVGFGKKRGPNS+
Sbjct: 25  PKVAKQDKKKKPRGRAHKRLQHNRRFVTAVVGFGKKRGPNSS 66

 Score = 39.7 bits (91), Expect = 0.037
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +2

Query: 26  GSLARAGKVRGQTPKGPQAGEEEAPAGPCHE 118
           GSLARAGKVRGQTPK  +  +++ P G  H+
Sbjct: 12  GSLARAGKVRGQTPKVAKQDKKKKPRGRAHK 42

>sp|Q05472|RS30_HUMAN 40S ribosomal protein S30 gi|1334234|emb|CAA44546.1| ribosomal
           protein S30 [Rattus rattus]
          Length = 59

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 30/42 (71%), Positives = 36/42 (85%)
 Frame = +3

Query: 66  PRVPKQEKKKRPRGRAMKRMKYNRRFVNVVVGFGKKRGPNSN 191
           P+V KQEKKK+  GRA +RM+YNRRFVNVV  FGKK+GPN+N
Sbjct: 17  PKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNAN 58

 Score = 33.9 bits (76), Expect = 2.1
 Identities = 16/27 (59%), Positives = 20/27 (73%)
 Frame = +2

Query: 26  GSLARAGKVRGQTPKGPQAGEEEAPAG 106
           GSLARAGKVRGQTPK  +  +++   G
Sbjct: 4   GSLARAGKVRGQTPKVAKQEKKKKKTG 30

>ref|XP_345683.1| similar to fusion protein [Rattus norvegicus]
          Length = 151

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 30/42 (71%), Positives = 36/42 (85%)
 Frame = +3

Query: 66  PRVPKQEKKKRPRGRAMKRMKYNRRFVNVVVGFGKKRGPNSN 191
           P+V KQEKKK+  GRA +RM+YNRRFVNVV  FGKK+GPN+N
Sbjct: 109 PKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNAN 150

 Score = 33.9 bits (76), Expect = 2.1
 Identities = 16/27 (59%), Positives = 20/27 (73%)
 Frame = +2

Query: 26  GSLARAGKVRGQTPKGPQAGEEEAPAG 106
           GSLARAGKVRGQTPK  +  +++   G
Sbjct: 96  GSLARAGKVRGQTPKVAKQEKKKKKTG 122



EST assemble image


clone accession position
1 CL72e05_r AV397002 1 635
2 CL19b02_r AV394151 4 592
3 CL18d10_r AV394069 6 395
4 MX235h08_r BP091243 7 347
5 CL09b10_r AV393721 12 619
6 CL09c12_r AV393740 13 640
7 CL70a03_r AV396830 13 668
8 CL71a03_r AV396883 14 664
9 CL30c10_r AV394775 14 509
10 CL41g12_r AV395435 15 623
11 CL46f12_r AV395670 16 645
12 CL54a01_r AV396168 16 650
13 CL22c08_r AV394248 16 639
14 CL15b01_r AV393940 16 666
15 CL18h09_r AV394066 19 509
16 CL49e01_r AV397719 23 623
17 CL30b11_r AV394763 23 639
18 MX028d08_r BP087226 24 594
19 CL79h05_r AV397145 24 595
20 CL21d11_r AV394369 26 675
21 CL75f08_r AV397083 27 654
22 CL56e05_r AV396080 30 613
23 CL38c04_r AV395294 30 639
24 CL64a01_r AV396608 32 649
25 CL55d08_r AV396027 35 634
26 MXL031h08_r BP094897 85 196
27 CM034g03_r AV388623 92 393
28 CL51g03_r AV395946 92 570
29 CL51h02_r AV395897 92 630
30 CM070b01_r AV391266 92 540
31 CM055b06_r AV390193 96 563
32 CL72h08_r AV397021 96 612
33 CL25d04_r AV394523 96 664
34 HCL014d09_r AV640335 98 584
35 CL33g12_r AV394962 98 645
36 CL31c12_r AV395017 98 650
37 CL50g10_r AV395764 98 634
38 HC014c03_r AV632910 98 588
39 MXL059c02_r BP096467 98 509
40 CL42e08_r AV395499 98 589
41 CL22b12_r AV394254 98 593
42 CL29a07_r AV394638 98 594
43 MXL064c09_r BP096754 98 494
44 LC075d06_r AV624274 98 617
45 CL18b08_r AV394076 98 568
46 CM048b12_r AV389080 98 493
47 CL44f07_r AV395581 98 653
48 CL62c12_r AV396445 98 663
49 LC079g10_r AV624588 98 619
50 CL13h05_r AV393921 98 627
51 CL37c09_r AV395278 98 590
52 CL75b04_r AV397066 98 638
53 LCL079a12_r AV630453 99 550
54 CL02e12_r AV397628 100 659
55 LC076b11_r AV624326 100 599
56 CL40h09_r AV395352 100 636
57 CM072h12_r AV391458 100 731
58 CL06b03_r AV393607 101 527
59 CL11b02_r AV393753 102 594
60 HCL069c09_r AV643414 104 639
61 CM059f04_r AV390669 104 589
62 CL74a10_r AV396475 104 639
63 CL25a12_r AV394555 104 664
64 CL74a06_r AV396455 104 668
65 CL48g05_r AV395787 104 626
66 CL29f04_r AV394678 104 471
67 CL06c03_r AV393608 104 504
68 CL02e11_r AV397591 104 649
69 CL23f11_r AV394493 104 632
70 CL22e03_r AV394222 104 652
71 CL54b12_r AV396153 104 573
72 CL04a09_r AV393384 104 666
73 CL34a09_r AV394908 104 607
74 CL23f10_r AV394460 104 619
75 CL22g12_r AV394257 104 662
76 CL48c11_r AV395833 104 653
77 CL30a08_r AV394753 104 641
78 CL68b01_r AV396909 104 654
79 CL42h10_r AV395495 104 656
80 CL31h06_r AV395030 104 657
81 CL68c01_r AV396910 104 658
82 CL69d06_r AV396789 104 666
83 CL50d07_r AV395749 104 634
84 CM038b02_r AV389003 104 629
85 CL67a01_r AV396683 104 662
86 MXL053c08_r BP096133 105 550
87 CL29e09_r AV394668 105 658
88 CL21d08_r AV394399 105 646
89 CL10f01_r AV393671 105 650
90 CM029b03_r AV389357 105 672
91 CM002b11_r AV397869 105 619
92 CL39g03_r AV395190 105 642
93 CM010a11_r AV386980 105 626
94 CL15h05_r AV393987 105 507
95 CS001d01_r AV398002 105 650
96 CL70g10_r AV396866 105 665
97 CM001b12_r AV386489 106 679
98 CL26f02_r AV394574 106 653
99 CS001c05_r AV398008 106 653
100 CM037f06_r AV388848 106 685
101 CM054b01_r AV389981 106 445
102 CM002c11_r AV397871 106 493
103 CM054d07_r AV390025 106 492
104 CM083c06_r AV392178 106 661
105 CM029a04_r AV389342 106 666
106 CL35g07_r AV395103 106 617
107 CL08c08_r AV393534 106 669
108 CL13a10_r AV393925 106 640
109 CM025e10_r AV388140 106 725
110 CM065a08_r AV391111 106 708
111 CL62d05_r AV396434 107 653
112 CL37c12_r AV395236 107 622
113 CL72f05_r AV397003 108 593
114 MXL031d01_r BP094866 108 480
115 CL41c12_r AV395432 108 668
116 CL43e12_r AV395514 108 663
117 CL33g04_r AV394976 108 642
118 CL30a09_r AV394768 108 667
119 CL07b04_r AV393446 108 664
120 CL19d10_r AV394203 108 637
121 CL54c04_r AV396135 108 648
122 CL23d02_r AV394485 109 650
123 CL36b10_r AV395157 109 537
124 CM048h12_r AV389085 109 491
125 CL76g12_r AV397124 109 649
126 CL23b09_r AV394506 109 626
127 CL27c08_r AV394720 110 590
128 CL44h09_r AV395610 110 663
129 CL32h03_r AV394865 110 665
130 CL38b04_r AV395289 110 650
131 CL21a01_r AV394373 110 585
132 CL23c07_r AV394478 110 637
133 CL37d06_r AV395270 110 268
134 CL09d08_r AV393730 111 622
135 CM061a10_r AV390595 111 622
136 CM051c07_r AV389857 111 649
137 CL41e03_r AV395425 111 612
138 CL52d03_r AV395837 111 639
139 CL24d11_r AV394456 111 646
140 CL10c05_r AV393674 112 626
141 CL22f09_r AV394269 112 644
142 CL75e05_r AV397104 112 647
143 CL43b12_r AV395511 112 666
144 CL70c06_r AV396848 112 696
145 CL07h02_r AV393475 112 640
146 CL53a06_r AV395957 112 689
147 CL66g08_r AV396757 113 664
148 CL47g05_r AV395691 113 619
149 MX001d08_r BP086075 113 544
150 CM002c08_r AV397824 113 692
151 HC031e12_r AV634296 113 614
152 CL27g11_r AV394698 113 625
153 CL37e11_r AV395238 113 671
154 CM074g07_r AV391545 113 760
155 CL20h09_r AV394322 113 608
156 CL22a12_r AV394253 113 612
157 CL17c05_r AV394106 113 622
158 CL58f03_r AV396203 113 650
159 CL16c07_r AV394017 113 667
160 CL28e04_r AV394817 113 638
161 CL23a11_r AV394490 113 629
162 CL41g10_r AV395415 113 607
163 CL25h10_r AV394563 113 617
164 HCL034c02_r AV641472 113 573
165 CL03c05_r AV393413 114 667
166 CL52d04_r AV395880 114 641
167 CL42g10_r AV395494 114 642
168 CL24f12_r AV394440 114 626
169 CL77e12_r AV397259 114 664
170 CL44d09_r AV395608 114 640
171 CL26d09_r AV394616 114 561
172 CL67f09_r AV396704 114 661
173 CL02f12_r AV397629 114 662
174 CL35h06_r AV395067 114 650
175 CL41d09_r AV395407 114 627
176 CL60a07_r AV396348 114 672
177 CL39g11_r AV395217 114 654
178 CL31d11_r AV395033 114 618
179 CL74e03_r AV396483 114 666
180 CL53h11_r AV395996 114 693
181 CL56c10_r AV396125 114 666
182 CL37e07_r AV395280 114 619
183 CL75f03_r AV397102 114 670
184 CL37e03_r AV395261 114 639
185 CL05d04_r AV393567 114 672
186 CL32h04_r AV394858 115 674
187 CL54g10_r AV396182 115 641
188 CL56e02_r AV396096 115 619
189 CL48f01_r AV395783 115 664
190 CL33b02_r AV394988 115 393
191 CL29f12_r AV394646 115 626
192 CL77d10_r AV397289 116 641
193 CL59f08_r AV397933 116 674
194 CL80b09_r AV397305 116 621
195 CL71c04_r AV396877 116 658
196 CL25a08_r AV394525 116 657
197 CL45g08_r AV397766 116 559
198 CL65d06_r AV396601 116 654
199 CL52h08_r AV395888 116 664
200 CL31g12_r AV395021 117 669
201 CM013c05_r AV387053 117 629
202 HC086c10_r AV387053 118 614
203 CL27b12_r AV394682 118 661
204 CL27b11_r AV394695 118 604
205 MXL024c06_r BP094513 118 469
206 CL39g07_r AV395207 118 620
207 CL05d11_r AV393581 118 547
208 CL02b08_r AV397609 120 654
209 HCL005d02_r AV639810 120 536
210 CL78d06_r AV397222 120 554
211 CL70e03_r AV396833 121 667
212 CM034a12_r AV388657 121 699
213 CL07b10_r AV393442 121 657
214 CL52c02_r AV395851 121 663
215 CL74d05_r AV396468 121 672
216 CL03a07_r AV393435 121 669
217 CL52e03_r AV395838 123 540
218 CL10c04_r AV393685 123 665
219 CL50d06_r AV395730 123 673
220 CL17c03_r AV394129 123 664
221 CL42b04_r AV395468 125 638
222 CL40h11_r AV395392 125 629
223 MXL022b07_r BP094371 127 612
224 CL06d10_r AV393652 127 638
225 CL66h10_r AV396750 128 629
226 CL47e08_r AV395703 128 653
227 CL70b03_r AV396831 129 652
228 CL60g06_r AV396365 129 666
229 CL55g03_r AV396038 130 611
230 CL28b07_r AV394784 130 627
231 CL63d10_r AV396508 131 664
232 CL32h06_r AV394878 132 663
233 CL23h08_r AV394469 132 674
234 CL75e07_r AV397044 132 664
235 CL65c02_r AV396593 133 661
236 CL30h11_r AV394767 134 674
237 CL09b02_r AV393745 134 662
238 CL61h08_r AV396303 135 656
239 CM058h10_r AV390343 136 680
240 CL25g08_r AV394567 137 651
241 HCL009c10_r AV640043 149 395
242 CL06a10_r AV393649 154 711
243 MX045g02_r BP087884 161 619
244 CL22b01_r AV394235 162 780
245 CL38d03_r AV395293 173 702
246 CL47b09_r AV395720 175 689
247 CL49a10_r AV397729 175 661
248 CM079a05_r AV391968 210 601
249 CL17f01_r AV394104 214 732
250 CL28h09_r AV394811 220 674
251 CL68d03_r AV396913 220 717
252 CM093c02_r AV392948 242 708
253 LC091a03_r AV625329 257 426
254 CM083c08_r AV392186 261 591
255 CL18c10_r AV394068 290 666
256 MXL095b03_r BP098542 401 653
257 CM031f11_r AV388334 410 664
258 CL79g04_r AV397153 474 651




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research