KCC000040A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000040A_C01 KCC000040A_c01
tatcaagcttacacttcaaccttgtaaccagaacaccaaatcctacctgtcctccttctc
ggcactacgttgccggccctAACCAATCGCTTTCTGACTGCTGGGCACTCCTAACGGACC
AGCCTCAGCTAAACAAAGACCTTCTCCCTACTTGTAAAGACACACACCAACTCATGTTGC
CAAGCTCAGGCCCACACTGCCCGCTTACGGTAGGCGAGCGCCTCCCATCAGTGATGGTGC
CACCGGGTGCAGCACACACGTACACGCACTACCTGCCCTCTGCACACATGGCGGCGAAAC
CCAGTGGACAACACGCCCCCTACCGCAGCGACGCAGCAGACGCAGCGCCACCGCCAATCT
CCATGAGGTATGGCATGTGCGCGTGTCGCGCCGCTGCTTGTTGGCCTCCTCCTCCTGCCC
CTGCAAAGCCAGGTTGCGCTGGCGGCGCTTAATGGTGCGCCTCCACCGACTTCTTGCCGG
ACTTCCACTCCTTGTACATCTCCAGCGCCTTGTGCTTGTCGGTCTCGCACACCCAGGTGC
CCTTCCAGCCCGAGGGGCACATCCCGATGGTGGGAAAGGGAGGGTTGAACGGGAAGTTCA
CGTCGATGAGCAGGTTGATGCCGACCATCACGAAGGCAACGTGCCGCAGAGCGACATATT
GCCCCCGGCTCTTGATGTACTGCTTGAAGTAGCTATCATAGAGGCTGTAGTCGTAGAAGA
ACTTCTCAAAGCCCTTgccaaggagctgcccgatagcagcggacattttgctgggggctg
tgggcctggcgaggtacgatacctactatgatctac


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000040A_C01 KCC000040A_c01
         (816 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAA81388.1| verprolin [Saccharomyces cerevisiae]                   36  0.006
gb|AAC82365.1| unknown [Myxococcus xanthus]                            33  0.007
emb|CAA61073.1| verprolin [Saccharomyces cerevisiae]                   35  0.014
ref|NP_013441.1| Involved in cytoskeletal organization and cellu...    35  0.014
ref|NP_572751.1| CG15741-PA [Drosophila melanogaster] gi|7292702...    40  0.035

>emb|CAA81388.1| verprolin [Saccharomyces cerevisiae]
          Length = 751

 Score = 36.2 bits (82), Expect(2) = 0.006
 Identities = 40/151 (26%), Positives = 55/151 (35%), Gaps = 17/151 (11%)
 Frame = +3

Query: 33  TPNPTCPPSRHYVAGPNQSLSDCWALLTDQPQLN-----KDLLPTCKDTHQLMLPSSGPH 197
           T N   PPS    AG    L++  A  +++  +      K      K   Q  LPSS P 
Sbjct: 257 TDNAVSPPSSEVPAGGLPFLAEINARRSERGAVEGVSSTKIQTENHKSPSQRPLPSSAPP 316

Query: 198 CPLTVGERLPSVMVPPGAAHTYTHYLPSAHMAAKPSGQHAPYRSDAAD-----AAP---- 350
            P +    LP    PP +    T     A  A +P     P    +A      A P    
Sbjct: 317 IPTSHAPPLPPTAPPPPSLPNVTSAPKKATSAPRPPPPPLPAAMSSASTNSVKATPVPPT 376

Query: 351 --PPISMRYGMCACRAAAC-WPPPPAPAKPG 434
             PP+     +   +A++   PPPP P  PG
Sbjct: 377 LAPPLPNTTSVPPNKASSMPAPPPPPPPPPG 407

 Score = 25.8 bits (55), Expect(2) = 0.006
 Identities = 15/40 (37%), Positives = 17/40 (42%)
 Frame = +1

Query: 427 SQVALAALNGAPPPTSCRTSTPCTSPAPCACRSRTPRCPS 546
           S + LA L   PPP S  TS P   P P    +  P   S
Sbjct: 418 SSIPLAPLP-PPPPPSVATSVPSAPPPPPTLTTNKPSASS 456

>gb|AAC82365.1| unknown [Myxococcus xanthus]
          Length = 542

 Score = 33.5 bits (75), Expect(2) = 0.007
 Identities = 25/97 (25%), Positives = 31/97 (31%), Gaps = 1/97 (1%)
 Frame = +3

Query: 147 PTCKDTHQLMLPSSGPHCPLTVGERLPSVMVPPGAAHTYTHYLPSAHMAAKPSGQHAPY- 323
           P C+       PS+G  CP        S   P G   +     P     + PS   +P  
Sbjct: 126 PRCRARPSAPAPSAGRTCPTAGPSSCASGCCPTGRCGSAPGPTPHGAEPSPPSQSPSPAP 185

Query: 324 RSDAADAAPPPISMRYGMCACRAAACWPPPPAPAKPG 434
            S        P   R       A AC PPP    +PG
Sbjct: 186 ASSGGRRRTHPRPARASAAGATAPACLPPPRCCGRPG 222

 Score = 28.5 bits (62), Expect(2) = 0.007
 Identities = 14/38 (36%), Positives = 17/38 (43%)
 Frame = +1

Query: 457 APPPTSCRTSTPCTSPAPCACRSRTPRCPSSPRGTSRW 570
           APP  +CR   P T+PAP         C S  R  + W
Sbjct: 259 APPSPACRPPPPGTTPAPRNAALPALPCISPSRQRATW 296

>emb|CAA61073.1| verprolin [Saccharomyces cerevisiae]
          Length = 817

 Score = 35.0 bits (79), Expect(2) = 0.014
 Identities = 37/139 (26%), Positives = 51/139 (36%), Gaps = 6/139 (4%)
 Frame = +3

Query: 33  TPNPTCPPSRHYVAGPNQSLSDCWALLTDQPQLN-----KDLLPTCKDTHQLMLPSSGPH 197
           T N   PPS    AG    L++  A  +++  +      K      K   Q  LPSS P 
Sbjct: 257 TDNAVSPPSSEVPAGGLPFLAEINARRSERGAVEGVSSTKIQTENHKSPSQPPLPSSAPP 316

Query: 198 CPLTVGERLPSVMVPPGAAHTYTHYLPSAHMAAKPSGQHAPYRSDAADA-APPPISMRYG 374
            P +    LP    PP          PS      P+   AP ++ +A A  PPP+     
Sbjct: 317 IPTSHAPPLPPTAPPP----------PSL-----PNVTSAPKKATSAPAPPPPPLPAAMS 361

Query: 375 MCACRAAACWPPPPAPAKP 431
             +  +    P PP  A P
Sbjct: 362 SASTNSVKATPVPPTLAPP 380

 Score = 25.8 bits (55), Expect(2) = 0.014
 Identities = 15/40 (37%), Positives = 17/40 (42%)
 Frame = +1

Query: 427 SQVALAALNGAPPPTSCRTSTPCTSPAPCACRSRTPRCPS 546
           S + LA L   PPP S  TS P   P P    +  P   S
Sbjct: 418 SSIPLAPLP-PPPPPSVATSVPSAPPPPPTLTTNKPSASS 456

>ref|NP_013441.1| Involved in cytoskeletal organization and cellular growth; Vrp1p
           [Saccharomyces cerevisiae]
           gi|2507155|sp|P37370|VRP1_YEAST Verprolin
           gi|1078464|pir||S51342 verprolin - yeast (Saccharomyces
           cerevisiae) gi|609392|gb|AAB67263.1| Vrp1p
           [Saccharomyces cerevisiae] gi|1585760|prf||2201477A MDP2
           gene
          Length = 817

 Score = 35.0 bits (79), Expect(2) = 0.014
 Identities = 37/139 (26%), Positives = 51/139 (36%), Gaps = 6/139 (4%)
 Frame = +3

Query: 33  TPNPTCPPSRHYVAGPNQSLSDCWALLTDQPQLN-----KDLLPTCKDTHQLMLPSSGPH 197
           T N   PPS    AG    L++  A  +++  +      K      K   Q  LPSS P 
Sbjct: 257 TDNAVSPPSSEVPAGGLPFLAEINARRSERGAVEGVSSTKIQTENHKSPSQPPLPSSAPP 316

Query: 198 CPLTVGERLPSVMVPPGAAHTYTHYLPSAHMAAKPSGQHAPYRSDAADA-APPPISMRYG 374
            P +    LP    PP          PS      P+   AP ++ +A A  PPP+     
Sbjct: 317 IPTSHAPPLPPTAPPP----------PSL-----PNVTSAPKKATSAPAPPPPPLPAAMS 361

Query: 375 MCACRAAACWPPPPAPAKP 431
             +  +    P PP  A P
Sbjct: 362 SASTNSVKATPVPPTLAPP 380

 Score = 25.8 bits (55), Expect(2) = 0.014
 Identities = 15/40 (37%), Positives = 17/40 (42%)
 Frame = +1

Query: 427 SQVALAALNGAPPPTSCRTSTPCTSPAPCACRSRTPRCPS 546
           S + LA L   PPP S  TS P   P P    +  P   S
Sbjct: 418 SSIPLAPLP-PPPPPSVATSVPSAPPPPPTLTTNKPSASS 456

>ref|NP_572751.1| CG15741-PA [Drosophila melanogaster] gi|7292702|gb|AAF48099.1|
           CG15741-PA [Drosophila melanogaster]
          Length = 135

 Score = 40.4 bits (93), Expect = 0.035
 Identities = 36/129 (27%), Positives = 61/129 (46%), Gaps = 3/129 (2%)
 Frame = -1

Query: 765 CPLLSGSSLARALRSSSTTTASMIATSSSTSRAGGNMSLCGTLPS*WSASTCSST*TSRS 586
           C L+  S LA A  +SST+ AS  + +SSTS          T P+  ++ T SS+ +S S
Sbjct: 5   CVLILASLLAVASSTSSTSPASSTSPASSTSPTSSTSPTSSTSPTSSTSPTSSSSSSSSS 64

Query: 585 TLPFPPSGCAPRAGRAPGCARPTST--RRWRCTRSGSPARSRW-RRTIKRRQRNLALQGQ 415
           T     +  AP        +  +S+  ++ R TR     R R  ++T K +++N     +
Sbjct: 65  TATTTTTTVAPTTTTTTEASSSSSSSDKKVRHTRHYVNRRHRKDKKTTKSKKKNSKKNKK 124

Query: 414 EEEANKQRR 388
            ++  + RR
Sbjct: 125 TKKVRRTRR 133



EST assemble image


clone accession position
1 CL02b06_r AV397585 1 544
2 HC049c10_r AV635667 370 816




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research