KCC000039A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000039A_C01 KCC000039A_c01
tTGCAATGCGATCATTGTCAGGGAGCGTTGCTCTCGGTTTGGGGCTCTTGCTTGGAACAT
TTCTGCTGGGCGGGAGCGCGCGCGGACTGCTCGCCGGTGGCTCACCAGCACAAGCTGCCG
GATCGTTTGACTCGAAGGAGGGATGCGCGACCATCATTGAGCAGGGCATGTACAAAACGT
TCTATGACCGCGGGGCTGCACCGGACGAGTACATGTCCTTCACAGCGGCTGTGTGCAGCC
TGACCCTCACAGCCGACTTGTATCCTGCTCTGCCAGCCTCCGAGTATGCCAACTTTCAGC
AGGTTGTCGCGCAGCTGGCGCCAAACCTGAAATCAACGAGATGGAGTTCCACATCGGCTT
TCCTCGACTACTGGACGGCGACGAACGACCCCGACGTGGCTAGCGCCACAGCAATGGGCG
CATACGCACCTTACGCAAGGGTGCGGGCGTACGTACTCACCGTGTGCCGTGGCCTTTCAA
CAGCCTCCGCGCCAGACCTGACAGACACCGATTTTGAGCTTGCCGGTACGGTTTTGACCA
CGAGCACGCGCTCCACGTTTATGAGCTGCGTTCAACTTGAGGCAGCGGGGCTGCAGCTGC
TGCGCACTTCAGCCGTCGGCGCCAACCCCTTCACCATGCGCATGACCTTTGACGCCTCCA
CCGCCAGTAATCCTGCAAGCATGATCAAGGTGATCGAGCCTGTGCTTTCGTCTCCTTCTA
GCGCCGTAAGCTGCGCCTTCACCACAGCCAGCGGGAGCACGGTGCAATGGGAGGATGACC
GCAGTTTCACGCTCCAAGACAAGGCGACTATCACGGTTTCATGCAGTATTGCCCCCGCGG
CCTCCAACAACGGTCGCACGACGGCCGTGGCCCTTGGCTTCTACGTGGACGGTAGCTCAG
TCAGCTACGCTGCCACGCTGTTTAATGGGCTACCCTTCCCTCCCCCGCCACCGCGGCCGC
CTTCGCCTCCCCCACCTCCGCCGTCTCCTTCACCTCCCCCGCCTCCGGCACCGCCATCCC
CTCCGCCTCCTCCTCCGCCTTCCTGCGAGAGCTCCCTTCGCGGCCAGCCCTGCTATAAGC
TGTACTCACTGGAGAGCGCCGCGTCGCCCCTTCTGGAGCTGGTGGGGGCGCCTGCGGCTG
CGCTGCCTGCTGGTGGCGTCCTCGCCCAGATCCGGGCGCTGCTTGACGCCTTGCACACAG
CCAACCAAACGATCTACAAGCAGGCCGCTCAAATCGACTCCCTGCAAACCCAGATCAACG
ATCTTAAATCCAAGGCCGCTCAAGTTGACTCCCTACAAACCCAGATCAAGAACCTTACGA
CCAAGGCCGCTCAAGTTGACTCCCTACAAACCCAGATCAGGGACCTTACGGCCAAGGTGC
CGACCTCATCATCATCTGTGGACGTGCTCCGTCTGTGCATTGGCGAGGTTTGCCTGCAGC
AGTCCGCCAGCAACACCGCTAACAGTGACGGGCGCCTGTTCTTTGTGCGCAAGGGCACAT
CACTCGCGTCCGTACGCATCAGCACAGCTGACATAGATATGGACATCCTGCAAGTGTTTC
CCTACCGGGACGGCGGGGATAACCTGCCGTCGTTTCCCACGTTCTTCTTCGTTAATCAGT
ATACAGATTTTGGCATATATACTGGTTACTTCAACTCACGCCACACGTACGGGGGAAGGT
TGCTGATCGACAAAGTTTGCATTGGGGAGTCGTGTCTACGTGCTTCCAGTACAAGCGCCG
GCGTTCTGATGATCAGTGGCAAGGATGCCGATACCCGCCGTACCGCACACTTTGACACAC
GCCTTGGCGGGAGAGACATCTTCCGAGTGTACAGGGACCGCGATGGCAACTACCCATACT
TCTACTACAACAATGCGAATGGATTTGGAACCAACGACGGCGTCACCAACGACCTCTACG
CATGATGTGGTCTCTGCTAGTCTGCGCGGCCCCTGTCCAGGGATGGTCTGCTCTGCGCCC
TGCTTTTTGCAGCAAGTGCAACGAGTGTAGTGAACGGCATGGTGAAGAAGAGCCGCGTGG
GCGGTTGTGATTGGCGCGGCACACACAGAGACAATGCTGGTTGTTATTACTCAATGCAAA
CCTTGTGAGGTGCAGATCGGTAAAGCTGTGCCCATATGAGAATGTTACGTAAACTGTAAC
ATCCTGCTACCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000039A_C01 KCC000039A_c01
         (2172 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAB62280.1| hydroxyproline-rich glycoprotein DZ-HRGP [Volvox...    80  7e-15
sp|P21997|SSGP_VOLCA SULFATED SURFACE GLYCOPROTEIN 185 (SSG 185)...    83  2e-14
prf||1604369A sulfated surface glycoprotein SSG185                     82  3e-14
ref|NP_039845.1| Nuclear protein EBNA2 [Human herpesvirus 4] gi|...    82  4e-14
pir||T10798 pherophorin-S - Volvox carteri gi|1655699|emb|CAA690...    80  1e-13

>emb|CAB62280.1| hydroxyproline-rich glycoprotein DZ-HRGP [Volvox carteri f.
            nagariensis]
          Length = 409

 Score = 79.7 bits (195), Expect = 2e-13
 Identities = 29/36 (80%), Positives = 30/36 (82%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PPPPPP P PPPPP+PP PPPPPPP
Sbjct: 85   PSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPP 120

 Score = 77.8 bits (190), Expect(2) = 7e-15
 Identities = 29/37 (78%), Positives = 30/37 (80%)
 Frame = +3

Query: 930  LPFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            +P PPPPP PP PPP PP P PPPPP PPSPPPPPPP
Sbjct: 95   VPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPP 131

 Score = 77.4 bits (189), Expect = 1e-12
 Identities = 29/36 (80%), Positives = 29/36 (80%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PPSPPPPPP P PPPP  PP PPPPPPP
Sbjct: 100  PPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPP 135

 Score = 77.4 bits (189), Expect(2) = 2e-13
 Identities = 31/37 (83%), Positives = 31/37 (83%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPS 1043
            P PPPPP PPSPPPPPP P PPPPP PP PPPPPPPS
Sbjct: 114  PPPPPPPPPPSPPPPPPPP-PPPPPNPPPPPPPPPPS 149

 Score = 76.6 bits (187), Expect = 2e-12
 Identities = 29/37 (78%), Positives = 29/37 (78%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPS 1043
            P PPPPP PP PPPPPP P PP PP PP PPPPPPPS
Sbjct: 88   PPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPS 124

 Score = 75.5 bits (184), Expect = 4e-12
 Identities = 29/37 (78%), Positives = 30/37 (80%), Gaps = 1/37 (2%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPP-PPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PPPP PP P PPPPP PP+PPPPPPP
Sbjct: 109  PSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPP 145

 Score = 75.1 bits (183), Expect = 5e-12
 Identities = 29/36 (80%), Positives = 29/36 (80%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP  PP PPSPSPPPPP PP PPPPPPP
Sbjct: 67   PPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPP 102

 Score = 74.7 bits (182), Expect = 6e-12
 Identities = 29/36 (80%), Positives = 29/36 (80%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PPPPPPSP PPPPP PP PP PPPP
Sbjct: 94   PVPPPPP-PPPPPPPPPSPPPPPPPPPPPPPSPPPP 128

 Score = 73.9 bits (180), Expect = 1e-11
 Identities = 28/36 (77%), Positives = 28/36 (77%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPP P PP PPPPPP PSPPPPP PP PPPP PP
Sbjct: 105  PPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPP 140

 Score = 73.9 bits (180), Expect = 1e-11
 Identities = 28/36 (77%), Positives = 28/36 (77%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PP PP PP PPPPPP PSPPPPP PP PPPP PP
Sbjct: 91   PPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPP 126

 Score = 73.9 bits (180), Expect = 1e-11
 Identities = 28/36 (77%), Positives = 28/36 (77%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P P PPP PP PPPPPPSP PPPPP PP PP PPPP
Sbjct: 107  PPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPP 142

 Score = 73.2 bits (178), Expect = 2e-11
 Identities = 28/37 (75%), Positives = 28/37 (75%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPS 1043
            P PPPPP PP PPPP P P PPPPP  PSPPP PPPS
Sbjct: 123  PSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPS 159

 Score = 72.4 bits (176), Expect = 3e-11
 Identities = 28/37 (75%), Positives = 28/37 (75%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPS 1043
            P PP PP PPSP PPPP P P PPP PP PPPPPPPS
Sbjct: 74   PPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPS 110

 Score = 72.4 bits (176), Expect = 3e-11
 Identities = 27/36 (75%), Positives = 27/36 (75%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP P PPPP P PPPPP  P PPPPPPP
Sbjct: 98   PPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPP 133

 Score = 72.0 bits (175), Expect = 4e-11
 Identities = 27/36 (75%), Positives = 27/36 (75%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP  P PPPPPP P PPP P PP PPPPPPP
Sbjct: 87   PPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPP 122

 Score = 72.0 bits (175), Expect = 4e-11
 Identities = 30/37 (81%), Positives = 30/37 (81%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPS 1043
            P PPPP  PP PPPPPPSPSPPP P PPSPPP PPPS
Sbjct: 132  PPPPPPNPPPPPPPPPPSPSPPPSP-PPSPPPSPPPS 167

 Score = 72.0 bits (175), Expect = 4e-11
 Identities = 27/36 (75%), Positives = 28/36 (77%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P P PPP PP PPPPPP+P PPPPP PPSP PPP P
Sbjct: 121  PPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSP 156

 Score = 72.0 bits (175), Expect = 4e-11
 Identities = 29/41 (70%), Positives = 30/41 (72%), Gaps = 5/41 (12%)
 Frame = +3

Query: 933  PFPPPPPRP-----PSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP+P     PSPPPPPP P PPPPP PP PPPPP P
Sbjct: 71   PPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSP 111

 Score = 71.6 bits (174), Expect = 5e-11
 Identities = 27/37 (72%), Positives = 28/37 (74%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPS 1043
            P PPP P PP PPPPPP P+PPPPP PP P P PPPS
Sbjct: 119  PPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPS 155

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 28/36 (77%), Positives = 28/36 (77%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P P PPP PP P PPPP P PPPPP PPSPPPPPPP
Sbjct: 83   PSPSPPPPPPPPVPPPPPP-PPPPPPPPSPPPPPPP 117

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 28/37 (75%), Positives = 28/37 (75%), Gaps = 1/37 (2%)
 Frame = +3

Query: 933  PFPPPPPRPPSPP-PPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PP PP PSP PPPPP  P PPPPPPP
Sbjct: 68   PPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPP 104

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 29/47 (61%), Positives = 31/47 (65%), Gaps = 1/47 (2%)
 Frame = +3

Query: 933  PFP-PPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPSCESSLRGQP 1070
            PFP PPPP PP P PPPPSP+PP PP P  PPP PPP   +  R  P
Sbjct: 307  PFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPP 353

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 31/42 (73%), Positives = 32/42 (75%), Gaps = 2/42 (4%)
 Frame = +3

Query: 924  NGLPFPPPPPRPPSPPP-PPPSPSPPPPPA-PPSPPPPPPPS 1043
            N  P PPPPP  PSPPP PPPSP P PPP+ PPSPPP PPPS
Sbjct: 138  NPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPS 179

 Score = 68.6 bits (166), Expect(2) = 4e-11
 Identities = 32/46 (69%), Positives = 32/46 (69%), Gaps = 9/46 (19%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPP------PPSPSPPPP-PAPPSPPP--PPPPS 1043
            PFPPP P PP PPPP      PP PSPPPP P PPSPPP  PPPPS
Sbjct: 235  PFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPS 280

 Score = 68.2 bits (165), Expect(2) = 7e-11
 Identities = 31/39 (79%), Positives = 31/39 (79%), Gaps = 3/39 (7%)
 Frame = +3

Query: 933  PFPPPP-PRPPSPPPP-PPSPSPPPP-PAPPSPPPPPPP 1040
            P PPPP P PPSPPPP PP PSPPPP P PPSPPPP PP
Sbjct: 249  PAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPP 287

 Score = 67.4 bits (163), Expect = 1e-09
 Identities = 25/36 (69%), Positives = 25/36 (69%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PP P  PP PPPP P P PPPPP PP P PPPPP
Sbjct: 80   PLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPP 115

 Score = 65.9 bits (159), Expect = 3e-09
 Identities = 27/37 (72%), Positives = 28/37 (74%), Gaps = 1/37 (2%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPP-PPPAPPSPPPPPPP 1040
            P  PPPP PP P PPPPSP+PP PPP  PSPP PPPP
Sbjct: 328  PPRPPPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPP 364

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 27/37 (72%), Positives = 27/37 (72%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPS 1043
            P P PPP PP  PPP P PSPPP P PPSPPP PPPS
Sbjct: 148  PSPSPPPSPPPSPPPSPPPSPPPSP-PPSPPPSPPPS 183

 Score = 65.5 bits (158), Expect = 4e-09
 Identities = 28/40 (70%), Positives = 28/40 (70%), Gaps = 5/40 (12%)
 Frame = +3

Query: 933  PFPPPPPRPPSPP-----PPPPSPSPPPPPAPPSPPPPPP 1037
            P  PPPPRPP P      PPPPSPSPP PP PPSPPP PP
Sbjct: 333  PPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSPPPRPP 372

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%), Gaps = 1/38 (2%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPA-PPSPPPPPPPS 1043
            P PPP P P  PP PPPSP P PPP+ PPSPPP PPPS
Sbjct: 166  PSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPS 203

 Score = 65.1 bits (157), Expect = 5e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%), Gaps = 1/38 (2%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPA-PPSPPPPPPPS 1043
            P PPP P P  PP PPPSP P PPP+ PPSPPP PPPS
Sbjct: 154  PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPS 191

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 24/35 (68%), Positives = 26/35 (73%)
 Frame = +3

Query: 939  PPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPS 1043
            PPP P PP PPPP P+P  PPPP+P  P PPPPPS
Sbjct: 332  PPPSPPPPRPPPPSPNPPRPPPPSPSPPKPPPPPS 366

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%), Gaps = 1/38 (2%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPA-PPSPPPPPPPS 1043
            P PPP P P  PP PPPSP P PPP+ PPSPPP PPPS
Sbjct: 174  PSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPS 211

 Score = 64.3 bits (155), Expect = 8e-09
 Identities = 32/46 (69%), Positives = 33/46 (71%), Gaps = 9/46 (19%)
 Frame = +3

Query: 933  PFPPPPPR-----PPSPPPP-PPSPSPPPP-PAPPSPPP--PPPPS 1043
            P P PPPR     PPSPPPP PP P+PPPP P PPSPPP  PPPPS
Sbjct: 225  PSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPS 270

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 2/45 (4%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPP--PPPAPPSPPPPPPPSCESSLR 1061
            P  PPPP PP P PPPPSP PP  PPP+PP P PPPP     S R
Sbjct: 253  PPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPR 297

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 5/42 (11%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPA-----PPSPPPPPPPS 1043
            P PPP P P  PP PPPSP P PPP+     PPSPPP PPPS
Sbjct: 158  PSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPS 199

 Score = 63.9 bits (154), Expect = 1e-08
 Identities = 26/37 (70%), Positives = 27/37 (72%), Gaps = 1/37 (2%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPA-PPSPPPPPPP 1040
            P PPP P P  PP PPPSP P PPP+ PPSPPP PPP
Sbjct: 150  PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 186

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 25/37 (67%), Positives = 25/37 (67%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPS 1043
            P P PPPRPP  PPP P PSPPP P P  PP P PPS
Sbjct: 180  PPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPS 216

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 30/52 (57%), Positives = 30/52 (57%), Gaps = 15/52 (28%)
 Frame = +3

Query: 933  PFPPPP-PRPPSPPPP--------PPSPSPP------PPPAPPSPPPPPPPS 1043
            P PPPP P PPSPPPP        PP PSPP      PPP  P PP PPPPS
Sbjct: 274  PLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPS 325

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 28/38 (73%), Positives = 28/38 (73%), Gaps = 3/38 (7%)
 Frame = +3

Query: 933  PFPPPP-PRPPSPPPP-PPSPSPPPP-PAPPSPPPPPP 1037
            P PPPP P PP PPPP PP PSPPPP P PPSP PP P
Sbjct: 264  PLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKP 301

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 24/35 (68%), Positives = 25/35 (70%), Gaps = 1/35 (2%)
 Frame = +3

Query: 939  PPPPPRPPSPPPPPPSP-SPPPPPAPPSPPPPPPP 1040
            PPP P PP PPPP PSP  PPPPP+PP  PP  PP
Sbjct: 342  PPPSPNPPRPPPPSPSPPKPPPPPSPPPRPPRRPP 376

 Score = 60.1 bits (144), Expect = 2e-07
 Identities = 23/35 (65%), Positives = 24/35 (67%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPP 1037
            P PPP P P  PP PPPSP P PPP+PP  PPP P
Sbjct: 178  PSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSP 212

 Score = 59.7 bits (143), Expect = 2e-07
 Identities = 26/39 (66%), Positives = 26/39 (66%), Gaps = 5/39 (12%)
 Frame = +3

Query: 939  PPPPPRPPSPPPPPPSPSPPPPPAP-----PSPPPPPPP 1040
            PPP P  P  PPPPP P PPPPP P     PSPPPPPPP
Sbjct: 56   PPPTPSGPEHPPPPP-PPPPPPPQPPLPPSPSPPPPPPP 93

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 26/47 (55%), Positives = 26/47 (55%), Gaps = 11/47 (23%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPS-----------PPPPPAPPSPPPPPPP 1040
            P PPP P PPSP PP PSP            PPP P PP PPPP PP
Sbjct: 206  PRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPP 252

 Score = 59.3 bits (142), Expect = 3e-07
 Identities = 25/38 (65%), Positives = 26/38 (67%), Gaps = 1/38 (2%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPP-PPAPPSPPPPPPPS 1043
            P P PPP PP  PPP P PSPPP PP  P+PP P PPS
Sbjct: 184  PPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPS 221

 Score = 58.9 bits (141), Expect(2) = 2e-08
 Identities = 27/50 (54%), Positives = 28/50 (56%), Gaps = 4/50 (8%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAP----PSPPPPPPPSCESSLRGQP 1070
            P PPP P P  PP PPPSP P PPP+P    P PP P PPS     R  P
Sbjct: 186  PRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPP 235

 Score = 58.9 bits (141), Expect = 4e-07
 Identities = 26/39 (66%), Positives = 27/39 (68%), Gaps = 6/39 (15%)
 Frame = +3

Query: 942  PPPPRPPSPPPPP-----PSPSPPPP-PAPPSPPPPPPP 1040
            PP P PPSP PPP     P PSPPPP P PP+PPPP PP
Sbjct: 219  PPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPP 257

 Score = 58.5 bits (140), Expect = 5e-07
 Identities = 24/34 (70%), Positives = 24/34 (70%), Gaps = 1/34 (2%)
 Frame = +3

Query: 942  PPPPRPPSPPPPPPSPSPP-PPPAPPSPPPPPPP 1040
            PPPP PP P PPPPSP PP PPP  P PP P PP
Sbjct: 266  PPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPP 299

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 24/38 (63%), Positives = 26/38 (68%), Gaps = 1/38 (2%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPP-PPPAPPSPPPPPPPS 1043
            P  P PP  P P PPPP+P PP PPP  P+PP PPPPS
Sbjct: 298  PPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPS 335

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 29/54 (53%), Positives = 30/54 (54%), Gaps = 18/54 (33%)
 Frame = +3

Query: 933  PFPPPP-PRPPSPPPP-------------PPSPSPP----PPPAPPSPPPPPPP 1040
            P PPPP P PPSPPPP             PP PSPP    P P PP+PPPP PP
Sbjct: 269  PSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPP 322

 Score = 57.8 bits (138), Expect = 8e-07
 Identities = 29/44 (65%), Positives = 29/44 (65%), Gaps = 8/44 (18%)
 Frame = +3

Query: 933  PFPPPPPRPP-SPPPP---PPSPSP----PPPPAPPSPPPPPPP 1040
            P P PPPRPP SP PP   PPSPSP    PPP  PP PPP PPP
Sbjct: 200  PPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPPP 243

 Score = 57.4 bits (137), Expect = 1e-06
 Identities = 28/49 (57%), Positives = 29/49 (59%), Gaps = 13/49 (26%)
 Frame = +3

Query: 933  PFPPPP------PRPPSPPPP------PPSPSPPPP-PAPPSPPPPPPP 1040
            P PPPP      PRPP P PP      PP P+PPPP P PPSP PP PP
Sbjct: 284  PSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPP 332

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 1/37 (2%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPP-PAPPSPPPPPPP 1040
            P PP  P P  PPP PP P PPPP P PP PPPP PP
Sbjct: 301  PSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPP 337

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 24/41 (58%), Positives = 24/41 (58%), Gaps = 8/41 (19%)
 Frame = +3

Query: 942  PPPPRPPSPPPP--------PPSPSPPPPPAPPSPPPPPPP 1040
            PP PRPPSP PP        PP P P PPP  P PP PPPP
Sbjct: 214  PPSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPP 254

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 23/35 (65%), Positives = 23/35 (65%), Gaps = 1/35 (2%)
 Frame = +3

Query: 939  PPPPPRPPSPPPPPPS-PSPPPPPAPPSPPPPPPP 1040
            PPP   PP  PPP PS P  PPPP PP PPPP PP
Sbjct: 46   PPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPP 80

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 25/41 (60%), Positives = 25/41 (60%), Gaps = 6/41 (14%)
 Frame = +3

Query: 933  PFPPPP----PRPPSPPPPPPSPSPP--PPPAPPSPPPPPP 1037
            P PPPP    PRPP P P PP P PP  PPP PP  PP PP
Sbjct: 339  PRPPPPSPNPPRPPPPSPSPPKPPPPPSPPPRPPRRPPRPP 379

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 22/35 (62%), Positives = 22/35 (62%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPP 1037
            P PPPP   P  PPPPPSP P PP  PP PP  PP
Sbjct: 349  PRPPPPSPSPPKPPPPPSPPPRPPRRPPRPPRRPP 383

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 26/43 (60%), Positives = 28/43 (64%), Gaps = 8/43 (18%)
 Frame = +3

Query: 933  PFPPPPPRPP--SPPP--PPPSPS----PPPPPAPPSPPPPPP 1037
            P  PPP  PP  +PPP  PPP+PS    PPPPP PP PPP PP
Sbjct: 38   PAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPP 80

 Score = 54.7 bits (130), Expect = 7e-06
 Identities = 27/51 (52%), Positives = 30/51 (57%), Gaps = 2/51 (3%)
 Frame = +3

Query: 933  PFPP-PPPRPPSPPPPPPSPSPPP-PPAPPSPPPPPPPSCESSLRGQPCYK 1079
            P PP PPP  PSPP PPP PSPPP PP  P  PP  PP+    +   P Y+
Sbjct: 346  PNPPRPPPPSPSPPKPPPPPSPPPRPPRRPPRPPRRPPTAPGVVGFFPDYE 396

 Score = 36.2 bits (82), Expect = 2.5
 Identities = 20/60 (33%), Positives = 22/60 (36%), Gaps = 22/60 (36%)
 Frame = +3

Query: 927  GLPFPPPPPRPPSPPPPPPSPSPPPP----------------------PAPPSPPPPPPP 1040
            G P   PPPR         +P+ PPP                      P PP PPPPPPP
Sbjct: 18   GAPARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPP 77

 Score = 26.9 bits (58), Expect(2) = 7e-15
 Identities = 22/76 (28%), Positives = 26/76 (33%)
 Frame = +1

Query: 1159 SSPRSGRCLTPCTQPTKRSTSRPLKSTPCKPRSTILNPRPLKLTPYKPRSRTLRPRPLKL 1338
            S P S     P + P     S P +  P  P S   +P P       P      PRP   
Sbjct: 163  SPPPSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSP 222

Query: 1339 TPYKPRSGTLRPRCRP 1386
            +P  PR    RP   P
Sbjct: 223  SPPSPRPPPRRPPFPP 238

 Score = 24.3 bits (51), Expect(2) = 2e-08
 Identities = 18/60 (30%), Positives = 21/60 (35%)
 Frame = +1

Query: 1165 PRSGRCLTPCTQPTKRSTSRPLKSTPCKPRSTILNPRPLKLTPYKPRSRTLRPRPLKLTP 1344
            PR      P  +P   S   PL   P  P      P P   +P  P      PRP K +P
Sbjct: 244  PRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSP 303

 Score = 23.5 bits (49), Expect(2) = 4e-11
 Identities = 20/64 (31%), Positives = 23/64 (35%)
 Frame = +1

Query: 1162 SPRSGRCLTPCTQPTKRSTSRPLKSTPCKPRSTILNPRPLKLTPYKPRSRTLRPRPLKLT 1341
            SP     L P  +P K S   P    P  P      PRP   +P  PR     P P +  
Sbjct: 285  SPPPPSPLPPSPRPPKPSP--PNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPP 342

Query: 1342 PYKP 1353
            P  P
Sbjct: 343  PPSP 346

 Score = 23.1 bits (48), Expect(2) = 7e-11
 Identities = 25/88 (28%), Positives = 26/88 (29%), Gaps = 1/88 (1%)
 Frame = +1

Query: 613 PSAPTPSPCA*PLTPPPPVILQA*SR*SSLCFRLLLAP*AAPSPQPAGARCNGRMTAVSR 792
           P  P PSP   P   PPP                   P   PSP P   R         R
Sbjct: 185 PPRPPPSPPPSPPPSPPP----------------SPPPRPPPSPNPPSPRPPSPSPPSPR 228

Query: 793 SKTRRLS-RFHAVLPPRPPTTVARRPWP 873
              RR      +  PPRPP      P P
Sbjct: 229 PPPRRPPFPPPSPPPPRPPPPAPPPPRP 256

 Score = 22.3 bits (46), Expect(2) = 2e-13
 Identities = 21/67 (31%), Positives = 25/67 (36%), Gaps = 1/67 (1%)
 Frame = +1

Query: 1159 SSPRSGRCLTPCTQPTKRSTSRPLKSTPCKPRS-TILNPRPLKLTPYKPRSRTLRPRPLK 1335
            S P S     P + P     S P    P  P S    +PRP   +P  PR    RP    
Sbjct: 179  SPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPP 238

Query: 1336 LTPYKPR 1356
             +P  PR
Sbjct: 239  PSPPPPR 245

>sp|P21997|SSGP_VOLCA SULFATED SURFACE GLYCOPROTEIN 185 (SSG 185) gi|99441|pir||A33647
            sulfated surface glycoprotein 185 - Volvox carteri
            gi|1405821|emb|CAA35953.1| SULFATED SURFACE GLYCOPROTEIN
            185 [Volvox carteri]
          Length = 485

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 38/73 (52%), Positives = 43/73 (58%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPSCESSLRGQPCYKLYSLESAASPL 1112
            P PPPPP PP PPPPPP PSPPPPP PP PPPPPPP    S   +P         + SP 
Sbjct: 258  PSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKP--------PSPSPP 309

Query: 1113 LELVGAPAAALPA 1151
            +    +P + LPA
Sbjct: 310  VPPPPSPPSVLPA 322

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 31/37 (83%), Positives = 31/37 (83%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPS 1043
            P PPP PRPPSPPPP PSP PPPPP PP PPPPPPPS
Sbjct: 242  PSPPPSPRPPSPPPPSPSPPPPPPPPPP-PPPPPPPS 277

 Score = 75.9 bits (185), Expect = 3e-12
 Identities = 29/37 (78%), Positives = 30/37 (80%), Gaps = 1/37 (2%)
 Frame = +3

Query: 933  PFPPPP-PRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPP P PP PPPPPP P PPPPP+PP PPPPPPP
Sbjct: 251  PSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 33/75 (44%), Positives = 40/75 (53%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPSCESSLRGQPCYKLYSLESAASPL 1112
            P PPPPP PP PPP P  P  PP P+PP PPPP PPS   +  G P  +  S   ++ P 
Sbjct: 282  PPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPSPPSVLPAATGFPFCECVSRSPSSYPW 341

Query: 1113 LELVGAPAAALPAGG 1157
               V   +A   +GG
Sbjct: 342  RVTVANVSAVTISGG 356

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 31/60 (51%), Positives = 34/60 (56%), Gaps = 8/60 (13%)
 Frame = +3

Query: 885  VDGSSVSYAATLFNGLPFPPPPP-----RPPSPPPPPPSPSPPPP---PAPPSPPPPPPP 1040
            + G +V+      N  P PP P      RPPSPPP P  PSPPPP   P PP PPPPPPP
Sbjct: 212  LSGPNVNPIGPAPNNSPLPPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPP 271

 Score = 48.1 bits (113), Expect = 6e-04
 Identities = 21/39 (53%), Positives = 22/39 (55%), Gaps = 2/39 (5%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPS--PPPPPAPPSPPPPPPPS 1043
            P  P P   P PP P P+ S  PP PP  P PP PPPPS
Sbjct: 219  PIGPAPNNSPLPPSPQPTASSRPPSPPPSPRPPSPPPPS 257

 Score = 47.8 bits (112), Expect = 8e-04
 Identities = 24/39 (61%), Positives = 24/39 (61%), Gaps = 2/39 (5%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPS--PSPPPPPAPPSPPPPPPPS 1043
            P P   P PPSP P   S  PSPPP P PPSPP PP PS
Sbjct: 222  PAPNNSPLPPSPQPTASSRPPSPPPSPRPPSPP-PPSPS 259

 Score = 39.7 bits (91), Expect = 0.22
 Identities = 22/42 (52%), Positives = 23/42 (54%), Gaps = 3/42 (7%)
 Frame = +3

Query: 927  GLPFPPPPPRPPSP--PPPPPSPSPPPPPAPPSPPP-PPPPS 1043
            GL  P   P  P+P   P PPSP P     PPSPPP P PPS
Sbjct: 211  GLSGPNVNPIGPAPNNSPLPPSPQPTASSRPPSPPPSPRPPS 252

>prf||1604369A sulfated surface glycoprotein SSG185
          Length = 453

 Score = 82.4 bits (202), Expect = 3e-14
 Identities = 38/75 (50%), Positives = 44/75 (58%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPSCESSLRGQPCYKLYSLESAASPL 1112
            P PPPPP PP PPPPPP PSPPPPP PP PPPPPPP    S   +P         + SP 
Sbjct: 258  PSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKP--------PSPSPP 309

Query: 1113 LELVGAPAAALPAGG 1157
            +    +P+A   +GG
Sbjct: 310  VPPPPSPSAVTISGG 324

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 31/37 (83%), Positives = 31/37 (83%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPS 1043
            P PPP PRPPSPPPP PSP PPPPP PP PPPPPPPS
Sbjct: 242  PSPPPSPRPPSPPPPSPSPPPPPPPPPP-PPPPPPPS 277

 Score = 75.9 bits (185), Expect = 3e-12
 Identities = 29/37 (78%), Positives = 30/37 (80%), Gaps = 1/37 (2%)
 Frame = +3

Query: 933  PFPPPP-PRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPP P PP PPPPPP P PPPPP+PP PPPPPPP
Sbjct: 251  PSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 31/60 (51%), Positives = 34/60 (56%), Gaps = 8/60 (13%)
 Frame = +3

Query: 885  VDGSSVSYAATLFNGLPFPPPPP-----RPPSPPPPPPSPSPPPP---PAPPSPPPPPPP 1040
            + G +V+      N  P PP P      RPPSPPP P  PSPPPP   P PP PPPPPPP
Sbjct: 212  LSGPNVNPIGPAPNNSPLPPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPP 271

 Score = 48.1 bits (113), Expect = 6e-04
 Identities = 21/39 (53%), Positives = 22/39 (55%), Gaps = 2/39 (5%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPS--PPPPPAPPSPPPPPPPS 1043
            P  P P   P PP P P+ S  PP PP  P PP PPPPS
Sbjct: 219  PIGPAPNNSPLPPSPQPTASSRPPSPPPSPRPPSPPPPS 257

 Score = 47.8 bits (112), Expect = 8e-04
 Identities = 24/39 (61%), Positives = 24/39 (61%), Gaps = 2/39 (5%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPS--PSPPPPPAPPSPPPPPPPS 1043
            P P   P PPSP P   S  PSPPP P PPSPP PP PS
Sbjct: 222  PAPNNSPLPPSPQPTASSRPPSPPPSPRPPSPP-PPSPS 259

 Score = 39.7 bits (91), Expect = 0.22
 Identities = 22/42 (52%), Positives = 23/42 (54%), Gaps = 3/42 (7%)
 Frame = +3

Query: 927  GLPFPPPPPRPPSP--PPPPPSPSPPPPPAPPSPPP-PPPPS 1043
            GL  P   P  P+P   P PPSP P     PPSPPP P PPS
Sbjct: 211  GLSGPNVNPIGPAPNNSPLPPSPQPTASSRPPSPPPSPRPPS 252

>ref|NP_039845.1| Nuclear protein EBNA2 [Human herpesvirus 4]
            gi|119111|sp|P12978|EBN2_EBV EBNA-2 NUCLEAR PROTEIN
            gi|1083964|pir||S42442 nuclear protein EBNA2 - human
            herpesvirus 4 gi|1632787|emb|CAA24877.1| BYRF1, encodes
            EBNA-2 (Dambaugh et al, 1984; Dillner et al, 1984) [Human
            herpesvirus 4] gi|23893590|emb|CAD53395.1| EBNA-2 nuclear
            protein [Human herpesvirus 4]
          Length = 487

 Score = 82.0 bits (201), Expect = 4e-14
 Identities = 30/36 (83%), Positives = 30/36 (83%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PPPPPP P PPPPP PPSPPPPPPP
Sbjct: 61   PLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 96

 Score = 79.3 bits (194), Expect = 3e-13
 Identities = 29/36 (80%), Positives = 30/36 (82%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PPPPPP P PPPPP+PP PPPPPPP
Sbjct: 64   PPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 99

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 29/37 (78%), Positives = 29/37 (78%)
 Frame = +3

Query: 930  LPFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            LP PPPPP PP PPPPPP P PPPPP  P PPPPPPP
Sbjct: 62   LPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98

 Score = 74.3 bits (181), Expect = 8e-12
 Identities = 28/38 (73%), Positives = 29/38 (75%)
 Frame = +3

Query: 927  GLPFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            G+P P PPP PP PPPPPP P PPPPP PP P PPPPP
Sbjct: 57   GVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 94

 Score = 70.9 bits (172), Expect = 9e-11
 Identities = 28/42 (66%), Positives = 29/42 (68%)
 Frame = +3

Query: 915  TLFNGLPFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            T+F G     PPP PP PPPPPP P PPPPP PP PPPPP P
Sbjct: 49   TIFVGENTGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSP 90

 Score = 50.1 bits (118), Expect = 2e-04
 Identities = 20/36 (55%), Positives = 21/36 (57%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP P PPPP P PPPP    +    P P
Sbjct: 77   PPPPPPPPPPPPSPPPPPPPPPPPQRRDAWTQEPSP 112

 Score = 40.8 bits (94), Expect = 0.10
 Identities = 20/44 (45%), Positives = 23/44 (51%), Gaps = 8/44 (18%)
 Frame = +3

Query: 942  PPPPRPPSPPPPPPSPSPPPPPA--------PPSPPPPPPPSCE 1049
            PP P PPS  PPP +P+ PPP           PS PP  PP C+
Sbjct: 286  PPMPLPPSQLPPPAAPAQPPPGVINDQQLHHLPSGPPWWPPICD 329

 Score = 38.5 bits (88), Expect = 0.50
 Identities = 19/39 (48%), Positives = 20/39 (50%), Gaps = 6/39 (15%)
 Frame = +3

Query: 933  PFPPPPPRPPSP------PPPPPSPSPPPPPAPPSPPPP 1031
            P  P  P P SP      PP P  PS  PPPA P+ PPP
Sbjct: 268  PNDPDSPEPRSPTVFYNIPPMPLPPSQLPPPAAPAQPPP 306

 Score = 37.4 bits (85), Expect = 1.1
 Identities = 15/31 (48%), Positives = 17/31 (54%)
 Frame = +3

Query: 942  PPPPRPPSPPPPPPSPSPPPPPAPPSPPPPP 1034
            PP P PP+P PP     PP P  P + PP P
Sbjct: 197  PPRPTPPTPLPPATLTVPPRPTRPTTLPPTP 227

 Score = 37.0 bits (84), Expect = 1.4
 Identities = 26/95 (27%), Positives = 39/95 (40%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPSCESSLRGQPCYKLYSLESAASPL 1112
            P   P   PP P   PP P+PP P  P +   PP P+  ++L               +PL
Sbjct: 182  PLSQPRLTPPQPLMMPPRPTPPTPLPPATLTVPPRPTRPTTL-------------PPTPL 228

Query: 1113 LELVGAPAAALPAGGVLAQIRALLDALHTANQTIY 1217
            L ++  P    P     +  R  L  LH  +Q+++
Sbjct: 229  LTVLQRPTELQPTP---SPPRMHLPVLHVPDQSMH 260

 Score = 35.0 bits (79), Expect = 5.5
 Identities = 21/64 (32%), Positives = 24/64 (36%), Gaps = 13/64 (20%)
 Frame = +3

Query: 915  TLFNGLPFPPPPPRPPSPPPPPPSPSP-------------PPPPAPPSPPPPPPPSCESS 1055
            T+F  +P  P PP    PP  P  P P              PP  PP   PP P   +  
Sbjct: 280  TVFYNIPPMPLPPSQLPPPAAPAQPPPGVINDQQLHHLPSGPPWWPPICDPPQPSKTQGQ 339

Query: 1056 LRGQ 1067
             RGQ
Sbjct: 340  SRGQ 343

>pir||T10798 pherophorin-S - Volvox carteri gi|1655699|emb|CAA69032.1|
            pherophorin-S [Volvox carteri]
          Length = 599

 Score = 80.5 bits (197), Expect = 1e-13
 Identities = 30/36 (83%), Positives = 30/36 (83%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PPSPPPPPP P PPPPP PP PPPPPPP
Sbjct: 266  PPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301

 Score = 80.5 bits (197), Expect = 1e-13
 Identities = 30/36 (83%), Positives = 30/36 (83%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PPPPPPSP PPPPP PP PPPPPPP
Sbjct: 259  PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294

 Score = 80.5 bits (197), Expect = 1e-13
 Identities = 30/36 (83%), Positives = 30/36 (83%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PPPPPP PSPPPPP PP PPPPPPP
Sbjct: 257  PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292

 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 29/36 (80%), Positives = 30/36 (82%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PPPPPP P PPPPP+PP PPPPPPP
Sbjct: 251  PSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286

 Score = 77.4 bits (189), Expect = 1e-12
 Identities = 29/36 (80%), Positives = 29/36 (80%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PPSPPP PP P PPPPP PP PPPPPPP
Sbjct: 238  PPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273

 Score = 76.6 bits (187), Expect = 2e-12
 Identities = 30/37 (81%), Positives = 30/37 (81%), Gaps = 1/37 (2%)
 Frame = +3

Query: 933  PFPPP-PPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPP PP PP PPPPPP P PPPPP PPSPPPPPPP
Sbjct: 247  PSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283

 Score = 75.5 bits (184), Expect = 4e-12
 Identities = 28/36 (77%), Positives = 28/36 (77%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PPPPPP P P PPP PP PPPPPPP
Sbjct: 255  PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290

 Score = 75.5 bits (184), Expect = 4e-12
 Identities = 28/36 (77%), Positives = 28/36 (77%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PPPPPP P PPP P PP PPPPPPP
Sbjct: 253  PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 288

 Score = 75.5 bits (184), Expect = 4e-12
 Identities = 28/36 (77%), Positives = 28/36 (77%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PPPP P P PPPPP PP PPPPPPP
Sbjct: 261  PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296

 Score = 75.5 bits (184), Expect = 4e-12
 Identities = 28/36 (77%), Positives = 28/36 (77%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP P PPPP P PPPPP PP PPPPPPP
Sbjct: 264  PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299

 Score = 75.5 bits (184), Expect = 4e-12
 Identities = 28/36 (77%), Positives = 28/36 (77%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PPP PP P PPPPP PP PPPPPPP
Sbjct: 262  PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297

 Score = 75.5 bits (184), Expect = 4e-12
 Identities = 28/36 (77%), Positives = 28/36 (77%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PPPPPP P PP PP PP PPPPPPP
Sbjct: 254  PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 289

 Score = 75.5 bits (184), Expect = 4e-12
 Identities = 28/36 (77%), Positives = 28/36 (77%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PP PPP P PPPPP PP PPPPPPP
Sbjct: 263  PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298

 Score = 75.1 bits (183), Expect = 5e-12
 Identities = 28/36 (77%), Positives = 29/36 (79%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPP  PPSPPPPPP P P PPP+PP PPPPPPP
Sbjct: 227  PPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPP 262

 Score = 75.1 bits (183), Expect = 5e-12
 Identities = 34/52 (65%), Positives = 36/52 (68%), Gaps = 5/52 (9%)
 Frame = +3

Query: 900  VSYAATLFNGLPFPPPPPRPPSPPP-----PPPSPSPPPPPAPPSPPPPPPP 1040
            +S A+TL   LP  PP P PPSPPP     PPPSP PPPPP PPSPPP PPP
Sbjct: 204  ISQASTLPLPLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPP 255

 Score = 74.3 bits (181), Expect = 8e-12
 Identities = 29/36 (80%), Positives = 29/36 (80%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP PP PPPSP PPPPP PP PPPPPPP
Sbjct: 236  PSPPPPP-PPPPPSPPPSPPPPPPPPPPPPPPPPPP 270

 Score = 74.3 bits (181), Expect = 8e-12
 Identities = 28/36 (77%), Positives = 28/36 (77%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPP  PPSPPPPPP P PPPPP PP PPPPP P
Sbjct: 242  PPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSP 277

 Score = 73.9 bits (180), Expect = 1e-11
 Identities = 30/38 (78%), Positives = 31/38 (80%), Gaps = 1/38 (2%)
 Frame = +3

Query: 930  LPFPPPPPRPPSPPPPPPSPSPPPPPA-PPSPPPPPPP 1040
            LP  PPPP PPSPPP PP P PPPPP+ PPSPPPPPPP
Sbjct: 222  LPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPP 259

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 29/37 (78%), Positives = 29/37 (78%), Gaps = 1/37 (2%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPP-PSPSPPPPPAPPSPPPPPPP 1040
            P PPP P PP PPPPP P PSPPPPP PP PPPPPPP
Sbjct: 232  PSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPP 268

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 27/36 (75%), Positives = 27/36 (75%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P P PPP PP PPPPPP P PPPPP PP PP PPPP
Sbjct: 245  PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280

 Score = 72.4 bits (176), Expect = 3e-11
 Identities = 29/39 (74%), Positives = 29/39 (74%), Gaps = 3/39 (7%)
 Frame = +3

Query: 933  PFPPPPPRPPS---PPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPPP PP    PPPPPP PSPPP P PP PPPPPPP
Sbjct: 226  PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPP 264

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 26/38 (68%), Positives = 26/38 (68%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPPSC 1046
            P PPP P PP PPPPPP P PPPPP PP PPP  P  C
Sbjct: 271  PPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYPDQC 308

 Score = 68.2 bits (165), Expect = 6e-10
 Identities = 27/36 (75%), Positives = 27/36 (75%)
 Frame = +3

Query: 933  PFPPPPPRPPSPPPPPPSPSPPPPPAPPSPPPPPPP 1040
            P PPPP  PP PPPPPP   PPPPP PP PPPPPPP
Sbjct: 270  PPPPPPSPPPPPPPPPP---PPPPPPPPPPPPPPPP 302



EST assemble image


clone accession position
1 CM005d02_r AV386856 1 579
2 CL02a12_r AV397624 2 555
3 LC028a12_r AV620881 4 484
4 CM052c07_r AV390545 6 581
5 CM093h11_r AV392976 21 559
6 MXL055h04_r BP096277 24 397
7 HCL046c01_r AV642136 77 610
8 MX249e07_r BP092083 166 415
9 LCL060a06_r AV629507 201 656
10 MX245c02_r BP091850 344 847
11 CM056h07_r AV390306 384 929
12 LC049e03_r AV622422 548 957
13 LCL056b05_r AV629298 732 1276
14 MX203a03_r BP089216 759 1005
15 LC001h04_r AV618957 800 978
16 CM029c07_r AV389362 1141 1757
17 CM090b04_r AV392304 1158 1684
18 CM099g10_r AV393143 1168 1570
19 MX231d10_r BP090944 1223 1713
20 LCL056d09_r AV629316 1507 2024
21 CL64d08_r AV396631 1661 2184
22 HC018b06_r AV633214 1697 2223
23 LC007h01_r AV619398 1744 2228
24 CM031a11_r AV388329 2043 2185




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research