KCC000038A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000038A_C01 KCC000038A_c01
cttagtctgtagCTCAACACCAAGAACAATGGCCGATCGCGGTGGTGAGCGTGCAGAGCT
GCGGTGAGCTGTGGCTCTTTCGGCCGCGGCTTCGGCGGCCTGTGGCGACCGCTGGCCGTG
TGCCTGGGGTGCTCGCCGCTGCTCGCTGGCAAGAAGTGAGTGACGAGGAGAAGTGGGTGC
CCTGCACCAAGCTGGGCCGCCTCGTCCAGCAGGGGCAAGATTAAGTCGCTGGAGCGAGAT
CTACCTGTTCTCCATGCCCGTCAAGGAGTACCAGATTGTTGAGTACTTCCTGGGCTCGGC
TCTGAAGGACGAGGTGATGAAGATCATGGCCCGTGCAGAAGCAGACCCGCGCCGGCCAGC
GCACCCGGCTTCAAGGCCTTCGTGCGTGGTTGGTGACTTCAACGGCCACATCGGCCTGGG
CGTCAAGTGCGCCAAGGAGGTTGCCACCGCCATCCGCGGTGCCATCATCCAGGCCAAGAT
GTCCGTCGTGCCCGTCCGCCGCGGCTACTGGGGTAACAAGATCGTGCAAGGTGCACACCG
TGCCCACCAAGGTCACCGGCAAGTGCGGCTCGGTCACCATTCGCCTGACCCCCGCCCCCC
GTGGTGCCGGTATCGTGGCCGCCCGCACCCCCAAGAAGGTGCTGCAGATGGCCGGTATTG
AGGACTGCTACACCTGCTCGCGCGGCTCCACCAAGACCCTGGGCAACTTCGTGCGCGCCA
CCTTCAACGCGCTGTCGAGGACCTACGGCTTCCTGACCCCCGAGCTGTGGCGCGAGAGCA
AGTACACCAAGGCGCCCTTCCAGGAGTTCACCGACTTCCTGGCCAAGCCCCACATTGGCG
AGTCCAAGGGCGAGGCGTACGCCTACTAAGCGACCCTCTCCTGGCGCCCGCCGTGCCCTA
CGGTGACGCAAATGACGAACTACCAAGTTGGCGGCGAGCGGCCGGAGCGCTGCCGACTGG
CCCTGCCCATCGCCGTCTCCCCGAATTCGCCAGCGGCTGGCGAAGGCCCCCATGCAGGCG
TGCTGTAACCAGTATCTGGTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000038A_C01 KCC000038A_c01
         (1041 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_181715.1| 40S ribosomal protein S2 (RPS2C) [Arabidopsis t...   190  1e-47
gb|AAM62944.1| 40S ribosomal protein S2 [Arabidopsis thaliana]        187  9e-47
gb|AAM67061.1| ribosomal protein S2, putative [Arabidopsis thali...   182  4e-45
ref|NP_176134.1| 40S ribosomal protein S2 (RPS2A) [Arabidopsis t...   182  4e-45
ref|NP_564737.1| 40S ribosomal protein, putative [Arabidopsis th...   182  4e-45

>ref|NP_181715.1| 40S ribosomal protein S2 (RPS2C) [Arabidopsis thaliana]
           gi|3915847|sp|P49688|RS2_ARATH 40S ribosomal protein S2
           gi|25294522|pir||G84846 40S ribosomal protein S2
           [imported] - Arabidopsis thaliana
           gi|2335095|gb|AAC02764.1| 40S ribosomal protein S2
           [Arabidopsis thaliana] gi|15081715|gb|AAK82512.1|
           At2g41840/T11A7.6 [Arabidopsis thaliana]
           gi|22137092|gb|AAM91391.1| At2g41840/T11A7.6
           [Arabidopsis thaliana]
          Length = 285

 Score =  190 bits (483), Expect(2) = 1e-47
 Identities = 111/247 (44%), Positives = 144/247 (57%), Gaps = 2/247 (0%)
 Frame = +3

Query: 114 GRVPGVLAAARWQEVSDEEKWVPCTKLGRLVQQGQD*VAGARSTCSPCPSRSTRLLSTSW 293
           GR  G     R    S+EEKWVP TKLGRLV  G       +      P +  +++    
Sbjct: 34  GRGRGGRGGRRGGRASEEEKWVPVTKLGRLVAAGHIKQI-EQIYLHSLPVKEYQIIDMLI 92

Query: 294 ARL*RTR**RSWPVQKQTRAGQRTRLQGLRAWLVTSTATSAWASSAPRRLPPPSAVPSS- 470
               +    +  PVQKQTRAGQRTR    +A++V                   +A+  + 
Sbjct: 93  GPTLKDEVMKIMPVQKQTRAGQRTRF---KAFVVVGDGNGHVGLGVKCSKEVATAIRGAI 149

Query: 471 -RPRCPSCPSAAATGVTRSCKVHTVPTKVTGKCGSVTIRLTPAPRGAGIVAARTPKKVLQ 647
              +    P        +  K HTVP KVTGKCGSVT+R+ PAPRG+GIVAAR PKKVLQ
Sbjct: 150 ILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQ 209

Query: 648 MAGIEDCYTCSRGSTKTLGNFVRATFNALSRTYGFLTPELWRESKYTKAPFQEFTDFLAK 827
            AGI+D +T SRGSTKTLGNFV+ATF+ L +TYGFLTPE W+E++++++P+QE TDFLA 
Sbjct: 210 FAGIDDVFTSSRGSTKTLGNFVKATFDCLQKTYGFLTPEFWKETRFSRSPYQEHTDFLAS 269

Query: 828 PHIGESK 848
             +  SK
Sbjct: 270 KALSTSK 276

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/105 (60%), Positives = 76/105 (71%)
 Frame = +2

Query: 209 AGARLSRWSEIYLFSMPVKEYQIVEYFLGSALKDEVMKIMARAEADPRRPAHPASRPSCV 388
           A   + +  +IYL S+PVKEYQI++  +G  LKDEVMKIM   +   R       +   V
Sbjct: 65  AAGHIKQIEQIYLHSLPVKEYQIIDMLIGPTLKDEVMKIMP-VQKQTRAGQRTRFKAFVV 123

Query: 389 VGDFNGHIGLGVKCAKEVATAIRGAIIQAKMSVVPVRRGYWGNKI 523
           VGD NGH+GLGVKC+KEVATAIRGAII AK+SVVPVRRGYWGNKI
Sbjct: 124 VGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKI 168

 Score = 22.7 bits (47), Expect(2) = 1e-47
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +1

Query: 73 GSFGRGFGG 99
          G FGRGFGG
Sbjct: 17 GDFGRGFGG 25

>gb|AAM62944.1| 40S ribosomal protein S2 [Arabidopsis thaliana]
          Length = 285

 Score =  187 bits (476), Expect(2) = 9e-47
 Identities = 110/247 (44%), Positives = 143/247 (57%), Gaps = 2/247 (0%)
 Frame = +3

Query: 114 GRVPGVLAAARWQEVSDEEKWVPCTKLGRLVQQGQD*VAGARSTCSPCPSRSTRLLSTSW 293
           GR  G     R    S+EEKWVP TKLGR V  G       +      P +  +++    
Sbjct: 34  GRGRGGRGGRRGGRASEEEKWVPVTKLGRHVAAGHIKQI-EQIYLHSLPVKEYQIIDMLI 92

Query: 294 ARL*RTR**RSWPVQKQTRAGQRTRLQGLRAWLVTSTATSAWASSAPRRLPPPSAVPSS- 470
               +    +  PVQKQTRAGQRTR    +A++V                   +A+  + 
Sbjct: 93  GPTLKDEVMKIMPVQKQTRAGQRTRF---KAFVVVGDGNGHVGLGVKCSKEVATAIRGAI 149

Query: 471 -RPRCPSCPSAAATGVTRSCKVHTVPTKVTGKCGSVTIRLTPAPRGAGIVAARTPKKVLQ 647
              +    P        +  K HTVP KVTGKCGSVT+R+ PAPRG+GIVAAR PKKVLQ
Sbjct: 150 ILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQ 209

Query: 648 MAGIEDCYTCSRGSTKTLGNFVRATFNALSRTYGFLTPELWRESKYTKAPFQEFTDFLAK 827
            AGI+D +T SRGSTKTLGNFV+ATF+ L +TYGFLTPE W+E++++++P+QE TDFLA 
Sbjct: 210 FAGIDDVFTSSRGSTKTLGNFVKATFDCLQKTYGFLTPEFWKETRFSRSPYQEHTDFLAS 269

Query: 828 PHIGESK 848
             +  SK
Sbjct: 270 KALSTSK 276

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/105 (60%), Positives = 76/105 (71%)
 Frame = +2

Query: 209 AGARLSRWSEIYLFSMPVKEYQIVEYFLGSALKDEVMKIMARAEADPRRPAHPASRPSCV 388
           A   + +  +IYL S+PVKEYQI++  +G  LKDEVMKIM   +   R       +   V
Sbjct: 65  AAGHIKQIEQIYLHSLPVKEYQIIDMLIGPTLKDEVMKIMP-VQKQTRAGQRTRFKAFVV 123

Query: 389 VGDFNGHIGLGVKCAKEVATAIRGAIIQAKMSVVPVRRGYWGNKI 523
           VGD NGH+GLGVKC+KEVATAIRGAII AK+SVVPVRRGYWGNKI
Sbjct: 124 VGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKI 168

 Score = 22.7 bits (47), Expect(2) = 9e-47
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +1

Query: 73 GSFGRGFGG 99
          G FGRGFGG
Sbjct: 17 GDFGRGFGG 25

>gb|AAM67061.1| ribosomal protein S2, putative [Arabidopsis thaliana]
          Length = 284

 Score =  182 bits (462), Expect(2) = 4e-45
 Identities = 104/237 (43%), Positives = 140/237 (58%), Gaps = 2/237 (0%)
 Frame = +3

Query: 144 RWQEVSDEEKWVPCTKLGRLVQQGQD*VAGARSTCSPCPSRSTRLLSTSWARL*RTR**R 323
           R    S+E KWVP TKLGRLV   +      +      P +  +++        +    +
Sbjct: 43  RGGRASEETKWVPVTKLGRLVADNKI-TKLEQIYLHSLPVKEYQIIDHLVGPTLKDEVMK 101

Query: 324 SWPVQKQTRAGQRTRLQGLRAWLVTSTATSAWASSAPRRLPPPSAVPSS--RPRCPSCPS 497
             PVQKQTRAGQRTR    +A++V                   +A+  +    +    P 
Sbjct: 102 IMPVQKQTRAGQRTRF---KAFVVVGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVVPV 158

Query: 498 AAATGVTRSCKVHTVPTKVTGKCGSVTIRLTPAPRGAGIVAARTPKKVLQMAGIEDCYTC 677
                  +  K HTVP KVTGKCGSVT+R+ PAPRG+GIVAAR PKKVLQ AGI+D +T 
Sbjct: 159 RRGYWGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDVFTS 218

Query: 678 SRGSTKTLGNFVRATFNALSRTYGFLTPELWRESKYTKAPFQEFTDFLAKPHIGESK 848
           SRGSTKTLGNFV+ATF+ L +TYGFLTPE W+E++++++P+QE TDFL+   +  +K
Sbjct: 219 SRGSTKTLGNFVKATFDCLQKTYGFLTPEFWKETRFSRSPYQEHTDFLSTKAVSATK 275

 Score =  127 bits (319), Expect = 3e-28
 Identities = 64/105 (60%), Positives = 79/105 (74%)
 Frame = +2

Query: 209 AGARLSRWSEIYLFSMPVKEYQIVEYFLGSALKDEVMKIMARAEADPRRPAHPASRPSCV 388
           A  ++++  +IYL S+PVKEYQI+++ +G  LKDEVMKIM   +   R       +   V
Sbjct: 64  ADNKITKLEQIYLHSLPVKEYQIIDHLVGPTLKDEVMKIMP-VQKQTRAGQRTRFKAFVV 122

Query: 389 VGDFNGHIGLGVKCAKEVATAIRGAIIQAKMSVVPVRRGYWGNKI 523
           VGD NGH+GLGVKC+KEVATAIRGAII AK+SVVPVRRGYWGNKI
Sbjct: 123 VGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKI 167

 Score = 22.7 bits (47), Expect(2) = 4e-45
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +1

Query: 73 GSFGRGFGG 99
          G FGRGFGG
Sbjct: 17 GDFGRGFGG 25

>ref|NP_176134.1| 40S ribosomal protein S2 (RPS2A) [Arabidopsis thaliana]
           gi|11276533|pir||T50673 ribosomal protein S2 homolog XW6
           [imported] - Arabidopsis thaliana
           gi|6566272|dbj|BAA88263.1| similar to ribosomal protein
           S2 [Arabidopsis thaliana]
           gi|12321043|gb|AAG50639.1|AC082643_3 ribosomal protein
           S2, putative [Arabidopsis thaliana]
           gi|14423442|gb|AAK62403.1|AF386958_1 ribosomal protein
           S2, putative [Arabidopsis thaliana]
           gi|18181932|dbj|BAB83870.1| ribosomal protein S2
           [Arabidopsis thaliana] gi|18377554|gb|AAL66943.1|
           ribosomal protein S2, putative [Arabidopsis thaliana]
          Length = 284

 Score =  182 bits (462), Expect(2) = 4e-45
 Identities = 104/237 (43%), Positives = 140/237 (58%), Gaps = 2/237 (0%)
 Frame = +3

Query: 144 RWQEVSDEEKWVPCTKLGRLVQQGQD*VAGARSTCSPCPSRSTRLLSTSWARL*RTR**R 323
           R    S+E KWVP TKLGRLV   +      +      P +  +++        +    +
Sbjct: 43  RGGRASEETKWVPVTKLGRLVADNKI-TKLEQIYLHSLPVKEYQIIDHLVGPTLKDEVMK 101

Query: 324 SWPVQKQTRAGQRTRLQGLRAWLVTSTATSAWASSAPRRLPPPSAVPSS--RPRCPSCPS 497
             PVQKQTRAGQRTR    +A++V                   +A+  +    +    P 
Sbjct: 102 IMPVQKQTRAGQRTRF---KAFVVVGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVVPV 158

Query: 498 AAATGVTRSCKVHTVPTKVTGKCGSVTIRLTPAPRGAGIVAARTPKKVLQMAGIEDCYTC 677
                  +  K HTVP KVTGKCGSVT+R+ PAPRG+GIVAAR PKKVLQ AGI+D +T 
Sbjct: 159 RRGYWGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDVFTS 218

Query: 678 SRGSTKTLGNFVRATFNALSRTYGFLTPELWRESKYTKAPFQEFTDFLAKPHIGESK 848
           SRGSTKTLGNFV+ATF+ L +TYGFLTPE W+E++++++P+QE TDFL+   +  +K
Sbjct: 219 SRGSTKTLGNFVKATFDCLQKTYGFLTPEFWKETRFSRSPYQEHTDFLSTKAVSATK 275

 Score =  127 bits (319), Expect = 3e-28
 Identities = 64/105 (60%), Positives = 79/105 (74%)
 Frame = +2

Query: 209 AGARLSRWSEIYLFSMPVKEYQIVEYFLGSALKDEVMKIMARAEADPRRPAHPASRPSCV 388
           A  ++++  +IYL S+PVKEYQI+++ +G  LKDEVMKIM   +   R       +   V
Sbjct: 64  ADNKITKLEQIYLHSLPVKEYQIIDHLVGPTLKDEVMKIMP-VQKQTRAGQRTRFKAFVV 122

Query: 389 VGDFNGHIGLGVKCAKEVATAIRGAIIQAKMSVVPVRRGYWGNKI 523
           VGD NGH+GLGVKC+KEVATAIRGAII AK+SVVPVRRGYWGNKI
Sbjct: 123 VGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKI 167

 Score = 22.7 bits (47), Expect(2) = 4e-45
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +1

Query: 73 GSFGRGFGG 99
          G FGRGFGG
Sbjct: 17 GDFGRGFGG 25

>ref|NP_564737.1| 40S ribosomal protein, putative [Arabidopsis thaliana]
           gi|18406353|ref|NP_564740.1| 40S ribosomal protein S2
           (RPS2B) [Arabidopsis thaliana]
           gi|22330310|ref|NP_683443.1| 40S ribosomal protein,
           putative [Arabidopsis thaliana]
           gi|14475933|gb|AAK62780.1|AC027036_1 ribosomal protein
           S2, putative [Arabidopsis thaliana]
           gi|14475937|gb|AAK62784.1|AC027036_5 ribosomal protein
           S2, putative [Arabidopsis thaliana]
           gi|18086426|gb|AAL57668.1| At1g59359/T4M14_3
           [Arabidopsis thaliana] gi|18146720|dbj|BAB82426.1|
           ribosomal protein S2 [Arabidopsis thaliana]
           gi|18265370|dbj|BAB84012.1| ribosomal protein S2
           [Arabidopsis thaliana] gi|18265374|dbj|BAB84016.1|
           ribosomal protein S2 [Arabidopsis thaliana]
           gi|22137288|gb|AAM91489.1| At1g59359/T4M14_3
           [Arabidopsis thaliana]
          Length = 284

 Score =  182 bits (462), Expect(2) = 4e-45
 Identities = 104/237 (43%), Positives = 140/237 (58%), Gaps = 2/237 (0%)
 Frame = +3

Query: 144 RWQEVSDEEKWVPCTKLGRLVQQGQD*VAGARSTCSPCPSRSTRLLSTSWARL*RTR**R 323
           R    S+E KWVP TKLGRLV   +      +      P +  +++        +    +
Sbjct: 43  RGGRASEETKWVPVTKLGRLVADNKI-TKLEQIYLHSLPVKEYQIIDHLVGPTLKDEVMK 101

Query: 324 SWPVQKQTRAGQRTRLQGLRAWLVTSTATSAWASSAPRRLPPPSAVPSS--RPRCPSCPS 497
             PVQKQTRAGQRTR    +A++V                   +A+  +    +    P 
Sbjct: 102 IMPVQKQTRAGQRTRF---KAFVVVGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVVPV 158

Query: 498 AAATGVTRSCKVHTVPTKVTGKCGSVTIRLTPAPRGAGIVAARTPKKVLQMAGIEDCYTC 677
                  +  K HTVP KVTGKCGSVT+R+ PAPRG+GIVAAR PKKVLQ AGI+D +T 
Sbjct: 159 RRGYWGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDVFTS 218

Query: 678 SRGSTKTLGNFVRATFNALSRTYGFLTPELWRESKYTKAPFQEFTDFLAKPHIGESK 848
           SRGSTKTLGNFV+ATF+ L +TYGFLTPE W+E++++++P+QE TDFL+   +  +K
Sbjct: 219 SRGSTKTLGNFVKATFDCLQKTYGFLTPEFWKETRFSRSPYQEHTDFLSTKAVSATK 275

 Score =  127 bits (319), Expect = 3e-28
 Identities = 64/105 (60%), Positives = 79/105 (74%)
 Frame = +2

Query: 209 AGARLSRWSEIYLFSMPVKEYQIVEYFLGSALKDEVMKIMARAEADPRRPAHPASRPSCV 388
           A  ++++  +IYL S+PVKEYQI+++ +G  LKDEVMKIM   +   R       +   V
Sbjct: 64  ADNKITKLEQIYLHSLPVKEYQIIDHLVGPTLKDEVMKIMP-VQKQTRAGQRTRFKAFVV 122

Query: 389 VGDFNGHIGLGVKCAKEVATAIRGAIIQAKMSVVPVRRGYWGNKI 523
           VGD NGH+GLGVKC+KEVATAIRGAII AK+SVVPVRRGYWGNKI
Sbjct: 123 VGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKI 167

 Score = 22.7 bits (47), Expect(2) = 4e-45
 Identities = 8/9 (88%), Positives = 8/9 (88%)
 Frame = +1

Query: 73 GSFGRGFGG 99
          G FGRGFGG
Sbjct: 17 GDFGRGFGG 25



EST assemble image


clone accession position
1 HC013f08_r AV632865 1 425
2 CM097c08_r AV393173 68 590
3 CM003g04_r AV386577 102 685
4 LC055a05_r AV622817 166 765
5 HCL036e04_r AV641571 170 652
6 LC063g10_r AV623439 172 731
7 MXL100e09_r BP098873 178 685
8 LC064h08_r AV623512 234 783
9 CM032f01_r AV388503 271 658
10 MXL009f07_r BP093526 297 729
11 LC061e03_r AV623279 407 881
12 HC036c07_r AV634670 428 916
13 HC006e10_r AV632306 435 943
14 HC021a04_r AV633454 436 826
15 CM032h05_r AV388512 468 1025
16 LC093h07_r AV625510 487 864
17 CL31c05_r AV395042 497 980
18 HC098e08_r AV639373 513 988
19 CL74g09_r AV396474 522 951
20 CM083c09_r AV392192 539 1066
21 CL80c05_r AV397299 549 1064
22 CL03b07_r AV393436 556 1033
23 CL24d05_r AV394412 557 961
24 CL21d06_r AV394362 564 1086
25 CL48f12_r AV395820 574 1067
26 HCL007h08_r AV639958 594 1063
27 HC090g01_r AV638782 599 1091
28 CL08h09_r AV393527 623 1089
29 CL62g02_r AV396421 632 1089
30 CL69g03_r AV396817 643 1146
31 HC061b09_r AV636566 718 1089
32 LC005e09_r AV619237 763 1089
33 HCL100d05_r AV645264 766 1089
34 HCL100d07_r AV645266 766 1079
35 CM050g12_r AV389773 871 1117




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research