KCC000037A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000037A_C01 KCC000037A_c01
CACTCCGTTCGTCGCACCCCAGCCACCATGCAACAACAACCGGTGCTGCTGGCCCGCCTT
GTGGCCGGCACGCCTGCTCGCTCGGGAGCGGAATGTGCTCTGTTACTCGTCAATTGCCGG
TGCTGAGAAGGTGCCCATGAGCCAGTTCGAGCCGCACGAGTACCTGAACGACCGCTACAA
GGCCATTGAGGATCGCCTCAAGGTCGTGCGCAAGCGGCTGAACAAGCCGATGACGCTGGC
TGAGAAGGTTGTGTATGGTCACTTGGATGACCCCGAGAACGCAGAGATGAAGCGCGGCGT
GTCCTACCTGAGGCTGCGCCCTGACCGCGTGGCGATGCAGGACGCGACTGCGCAGATGGC
CATGCTTCAGTTCATCTCTTCGGGCCTGCCGAAGACCATGGTGCCCTCCACCATCCACTG
CGACCACCTGATTGAGGGCACCACCTCGCCCCAGCCGGACCGCGAGGGCAAGTTCGGCGG
CGAGGCGGACCTGTCCTTCGCCGTCAAGTCCAACAAGGAGGTGTACGACTTCCTGCGCTA
CCGCCGGCTCCAAGTATGGCGTCGGCTTCTGGCGCCCCGGCTCCGGTATCATTCACCAGA
TTGTGCTGGAGAACTACGCCCTGCCCGGCCTGATGATGATTGGCACGGACTCGCACACGC
CCAACGCCGGTGGCCTGGGTATGTGCGCGGTGGGCGTGGGTGGCGCCGACGCGGTGGACG
TGATGGCGGGCCTGCCCTGGGAGCTGAAGGCGCCCAAGGTGATCGGTGTCAAGCTGACGG
GCAAGATGTCCCGGTGGACCTCGCCCAAGGACGTCATCCTCAAGGTGGCGGGCATCCTGA
CGGTGAAGGGCGGCACTGGCGCCATCGTGGAGTACTTCGGCCCGGGCGTGGACCACATGA
GCTGCACCGGCATGGCAACGGTTTGCAACATGGGCGCTGAGATCGGTGCCACCACCTCCA
TGTTCCCTTACAACAAGCGCATGCACGACTACCTGGTCGCCACCGGCCGCGCGCCGGCCG
CCTCGCTGGCCGACTCGTTCAAGGAGCACCTGAAGGCGGACGAGGGCGCGCAGTACGACC
AGCTGATTGAGATCAACCTGTCCGAGCTGGAGCCGCACGTCAACGGCCCCTTCACGCCCG
ACCTGGCGCACCCGCTGTCCAAGTTCGCGGAGGAGATGCGCAAGAACGGCTGGCCCACGG
AGCTCAAGGCTGGCCTGATTGGCTCGTGCACCAACTCGTCCTACGAGGACATGGCGCGTG
CCGCCTCGGTGGCCCGCCAGGCGCTGGCTGCGGGCATCAAGGCCAAGGTGCCGTTCACTA
TCTCGCCCGGCAGCGAGCAGATCCGCGCCACCATTGCGCGCGACGGCATCATGGACGTGT
TCGACAAGATTGGCGGCACCGTGCTGTCCAACAGCTGCGGTCCCTGCATCGGCCAGTGGA
AGCGCACGGACGTGCCCAAGGGCGAGGCCAACTCCATCATCACCTCGTTCAACCGCAACT
TCGCGGCGCGCAACGACGGCAACCCCGCCACCCACTGCTTCGTGGCCTCGCCCGAGCTGG
TGACCGCCTACGCCATTGCCGGCGACCTGACCTTCAACCCCGAGAAGGACACCCTGGTCG
GCGCTGACGGCAAGGAGATCAAGCTGGAGGCGCCCCATGGCGACGAGCTGCCCTCGCGCG
GCTTCGACGCCGGCGCCAACGTGTACCAGGCGCCGCCGTCGTCTCTGGACGAGCGCGGCA
AGCTGTCCGTCAAAGTGGACCCCTGCCTCGCAGCTGCCTGCAGCTGCTGTCGCCCTTCAA
GGCCTGGAACGGCGATGACATCAAGGACGCCGCTGTGCTGATCAAGGTGAAGGGCAAGTG
CACCACCGACCACATCTCCATGGCTGGCCCCTGGCTCAAGTACCGCGGCCACCTGGACAA
CATCTCCAACAACCTGCTCATCGGCGCCATCAACATCGAGAACGGCAAGCCCAACGCCGT
CAAGAATGTGGTGACCGGTGCGGAGGGCCCCGTGCCCGCCACCGCCCGCGACTACAAGGC
CCGCGGCCTGCCGTGGGTGGTGGT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000037A_C01 KCC000037A_c01
         (2064 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P49609|ACON_GRAVE Aconitate hydratase, mitochondrial precurso...   649  0.0
sp|P16276|ACON_PIG Aconitate hydratase, mitochondrial precursor ...   602  0.0
pdb|1B0J|A Chain A, Crystal Structure Of Aconitase With Isocitrate    602  0.0
pdb|5ACN|   Aconitase (E.C.4.2.1.3) (Inactive (3fe-4s) Cluster F...   602  0.0
pdb|1C97|A Chain A, S642a:isocitrate Complex Of Aconitase gi|672...   602  0.0

>sp|P49609|ACON_GRAVE Aconitate hydratase, mitochondrial precursor (Citrate hydro-lyase)
            (Aconitase) gi|1361942|pir||S57805 aconitate hydratase
            (EC 4.2.1.3) precursor - red alga  (Gracilaria verrucosa)
            gi|600171|gb|AAA80494.1| aconitase
          Length = 779

 Score =  649 bits (1673), Expect(3) = 0.0
 Identities = 314/409 (76%), Positives = 349/409 (84%)
 Frame = +3

Query: 537  ATAGSKYGVGFWRPGSGIIHQIVLENYALPGLMMIGTDSHTPNAGGLGMCAVGVGGADAV 716
            A+AG+KYG+GFW+PGSGIIHQIVLENYA PGL+MIGTDSHTPNAGGLG CAVGVGGADAV
Sbjct: 153  ASAGAKYGLGFWKPGSGIIHQIVLENYAFPGLLMIGTDSHTPNAGGLGACAVGVGGADAV 212

Query: 717  DVMAGLPWELKAPKVIGVKLTGKMSRWTSPKDVILKVAGILTVKGGTGAIVEYFGPGVDH 896
            DVM GLPWELKAPKVIGVKLTGK+  W SPKDVILKVAGILTVKGGTGAIVEYFG GVD 
Sbjct: 213  DVMVGLPWELKAPKVIGVKLTGKLQEWASPKDVILKVAGILTVKGGTGAIVEYFGEGVDS 272

Query: 897  MSCTGMATVCNMGAEIGATTSMFPYNKRMHDYLVATGRAPAASLADSFKEHLKADEGAQY 1076
            +SCTGM T+CNMGAEIGATTSMFPYN RM DYL ATGR   ASLADSF E L+ADE A Y
Sbjct: 273  LSCTGMGTICNMGAEIGATTSMFPYNSRMGDYLKATGRDGIASLADSFSEQLRADENAVY 332

Query: 1077 DQLIEINLSELEPHVNGPFTPDLAHPLSKFAEEMRKNGWPTELKAGLIGSCTNSSYEDMA 1256
            DQLIEINLSELEPH+NGPFTPDLAHPLSKF EE+ KNGWP EL  GLIGSCTNSSYEDMA
Sbjct: 333  DQLIEINLSELEPHINGPFTPDLAHPLSKFKEEVEKNGWPAELTVGLIGSCTNSSYEDMA 392

Query: 1257 RAASVARQALAAGIKAKVPFTISPGSEQIRATIARDGIMDVFDKIGGTVLSNSCGPCIGQ 1436
            R+ASV +QAL+ G+K+K  F I+PGSEQ+RATI+RDGI+D F + GGTVL+N+CGPCIGQ
Sbjct: 393  RSASVVKQALSHGVKSKSIFNITPGSEQVRATISRDGILDTFTEAGGTVLANACGPCIGQ 452

Query: 1437 WKRTDVPKGEANSIITSFNRNFAARNDGNPATHCFVASPELVTAYAIAGDLTFNPEKDTL 1616
            W R+DVPKG  NSIITSFNRNF+ RNDGNP TH FVASPE+VTA ++AG L FNP  D+L
Sbjct: 453  WNRSDVPKGTPNSIITSFNRNFSQRNDGNPQTHAFVASPEIVTAMSLAGSLKFNPATDSL 512

Query: 1617 VGADGKEIKLEAPHGDELPSRGFDAGANVYQAPPSSLDERGKLSVKVDP 1763
             GADG E KL AP GDELP  GFD G + +Q PPS  D+   + V++DP
Sbjct: 513  QGADGAEFKLAAPSGDELPVMGFDPGEDTFQ-PPS--DDSTSILVQIDP 558

 Score =  150 bits (380), Expect(3) = 0.0
 Identities = 77/140 (55%), Positives = 97/140 (69%)
 Frame = +2

Query: 116 AGAEKVPMSQFEPHEYLNDRYKAIEDRLKVVRKRLNKPMTLAEKVVYGHLDDPENAEMKR 295
           A A + PMS  E H  L   Y AI+DRL  VR +LN+P+TLAEKV+YGHLDDPE   + R
Sbjct: 24  AAARQTPMSPLEAHNELEPVYAAIDDRLNTVRSKLNRPLTLAEKVLYGHLDDPERVPV-R 82

Query: 296 GVSYLRLRPDRVAMQDATAQMAMLQFISSGLPKTMVPSTIHCDHLIEGTTSPQPDREGKF 475
           G ++L+LRP+RVA+QDATAQMA++QF++S  P+  VPSTIHCDHLI            + 
Sbjct: 83  GETFLKLRPERVALQDATAQMALIQFMASARPQVAVPSTIHCDHLI----------AAEV 132

Query: 476 GGEADLSFAVKSNKEVYDFL 535
           G E D++ A   NKEVYDFL
Sbjct: 133 GAEEDMAKAKSQNKEVYDFL 152

 Score =  142 bits (359), Expect(3) = 0.0
 Identities = 67/95 (70%), Positives = 74/95 (77%)
 Frame = +2

Query: 1778 LQLLSPFKAWNGDDIKDAAVLIKVKGKCTTDHISMAGPWLKYRGHLDNISNNLLIGAINI 1957
            L  L PF AW+G D  D  VLIK +GKCTTDHISMAGPWLK+RGHLDNISNN+LIGA+N 
Sbjct: 563  LSFLEPFPAWDGKDYTDMPVLIKARGKCTTDHISMAGPWLKFRGHLDNISNNMLIGAVND 622

Query: 1958 ENGKPNAVKNVVTGAEGPVPATARDYKARGLPWVV 2062
            ENG+ N VKN VTG  G VP TAR YKA G+ WVV
Sbjct: 623  ENGEINNVKNAVTGEYGTVPDTARAYKAEGVKWVV 657

>sp|P16276|ACON_PIG Aconitate hydratase, mitochondrial precursor (Citrate hydro-lyase)
            (Aconitase) gi|108227|pir||A35544 aconitate hydratase (EC
            4.2.1.3) precursor, mitochondrial [validated] - pig
            gi|164315|gb|AAA30987.1| heart aconitase precursor
          Length = 781

 Score =  602 bits (1551), Expect(3) = 0.0
 Identities = 285/394 (72%), Positives = 322/394 (81%)
 Frame = +3

Query: 537  ATAGSKYGVGFWRPGSGIIHQIVLENYALPGLMMIGTDSHTPNAGGLGMCAVGVGGADAV 716
            ATAG+KYGVGFWRPGSGIIHQI+LENYA PG+++IGTDSHTPN GGLG   +GVGGADAV
Sbjct: 155  ATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAV 214

Query: 717  DVMAGLPWELKAPKVIGVKLTGKMSRWTSPKDVILKVAGILTVKGGTGAIVEYFGPGVDH 896
            DVMAG+PWELK PKVIGVKLTG +S WTSPKDVILKVAGILTVKGGTGAIVEY GPGVD 
Sbjct: 215  DVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDS 274

Query: 897  MSCTGMATVCNMGAEIGATTSMFPYNKRMHDYLVATGRAPAASLADSFKEHLKADEGAQY 1076
            +SCTGMAT+CNMGAEIGATTS+FPYN RM  YL  TGRA  A+LAD FK+HL  D G  Y
Sbjct: 275  ISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFKDHLVPDPGCHY 334

Query: 1077 DQLIEINLSELEPHVNGPFTPDLAHPLSKFAEEMRKNGWPTELKAGLIGSCTNSSYEDMA 1256
            DQ+IEINLSEL+PH+NGPFTPDLAHP+++      K GWP +++ GLIGSCTNSSYEDM 
Sbjct: 335  DQVIEINLSELKPHINGPFTPDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMG 394

Query: 1257 RAASVARQALAAGIKAKVPFTISPGSEQIRATIARDGIMDVFDKIGGTVLSNSCGPCIGQ 1436
            R+A+VA+QALA G+K K  FTI+PGSEQIRATI RDG   V   +GG VL+N+CGPCIGQ
Sbjct: 395  RSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQVLRDVGGIVLANACGPCIGQ 454

Query: 1437 WKRTDVPKGEANSIITSFNRNFAARNDGNPATHCFVASPELVTAYAIAGDLTFNPEKDTL 1616
            W R D+ KGE N+I+TS+NRNF  RND NP TH FV SPE+VTA AIAG L FNPE D L
Sbjct: 455  WDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDFL 514

Query: 1617 VGADGKEIKLEAPHGDELPSRGFDAGANVYQAPP 1718
             G DGK+ KLEAP  DELP   FD G + YQ PP
Sbjct: 515  TGKDGKKFKLEAPDADELPRAEFDPGQDTYQHPP 548

 Score =  176 bits (447), Expect(3) = 0.0
 Identities = 93/148 (62%), Positives = 109/148 (72%)
 Frame = +2

Query: 92  NVLCYSSIAGAEKVPMSQFEPHEYLNDRYKAIEDRLKVVRKRLNKPMTLAEKVVYGHLDD 271
           +VLC  +     KV MS FEPHEY+  RY  +E  + +VRKRLN+P+TL+EK+VYGHLDD
Sbjct: 24  SVLCQRA-----KVAMSHFEPHEYI--RYDLLEKNIDIVRKRLNRPLTLSEKIVYGHLDD 76

Query: 272 PENAEMKRGVSYLRLRPDRVAMQDATAQMAMLQFISSGLPKTMVPSTIHCDHLIEGTTSP 451
           P N E++RG +YLRLRPDRVAMQDATAQMAMLQFISSGLPK  VPSTIHCDHLI      
Sbjct: 77  PANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLI------ 130

Query: 452 QPDREGKFGGEADLSFAVKSNKEVYDFL 535
               E + GGE DL  A   N+EVY+FL
Sbjct: 131 ----EAQLGGEKDLRRAKDINQEVYNFL 154

 Score =  146 bits (369), Expect(3) = 0.0
 Identities = 69/95 (72%), Positives = 77/95 (80%)
 Frame = +2

Query: 1778 LQLLSPFKAWNGDDIKDAAVLIKVKGKCTTDHISMAGPWLKYRGHLDNISNNLLIGAINI 1957
            LQLL PF  W+G D++D  +LIKVKGKCTTDHIS AGPWLK+RGHLDNISNNLLIGAINI
Sbjct: 565  LQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINI 624

Query: 1958 ENGKPNAVKNVVTGAEGPVPATARDYKARGLPWVV 2062
            EN K N+V+N VT   GPVP TAR YK  G+ WVV
Sbjct: 625  ENRKANSVRNAVTQEFGPVPDTARYYKQHGIRWVV 659

>pdb|1B0J|A Chain A, Crystal Structure Of Aconitase With Isocitrate
          Length = 754

 Score =  602 bits (1551), Expect(3) = 0.0
 Identities = 285/394 (72%), Positives = 322/394 (81%)
 Frame = +3

Query: 537  ATAGSKYGVGFWRPGSGIIHQIVLENYALPGLMMIGTDSHTPNAGGLGMCAVGVGGADAV 716
            ATAG+KYGVGFWRPGSGIIHQI+LENYA PG+++IGTDSHTPN GGLG   +GVGGADAV
Sbjct: 128  ATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAV 187

Query: 717  DVMAGLPWELKAPKVIGVKLTGKMSRWTSPKDVILKVAGILTVKGGTGAIVEYFGPGVDH 896
            DVMAG+PWELK PKVIGVKLTG +S WTSPKDVILKVAGILTVKGGTGAIVEY GPGVD 
Sbjct: 188  DVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDS 247

Query: 897  MSCTGMATVCNMGAEIGATTSMFPYNKRMHDYLVATGRAPAASLADSFKEHLKADEGAQY 1076
            +SCTGMAT+CNMGAEIGATTS+FPYN RM  YL  TGRA  A+LAD FK+HL  D G  Y
Sbjct: 248  ISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFKDHLVPDPGCHY 307

Query: 1077 DQLIEINLSELEPHVNGPFTPDLAHPLSKFAEEMRKNGWPTELKAGLIGSCTNSSYEDMA 1256
            DQ+IEINLSEL+PH+NGPFTPDLAHP+++      K GWP +++ GLIGSCTNSSYEDM 
Sbjct: 308  DQVIEINLSELKPHINGPFTPDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMG 367

Query: 1257 RAASVARQALAAGIKAKVPFTISPGSEQIRATIARDGIMDVFDKIGGTVLSNSCGPCIGQ 1436
            R+A+VA+QALA G+K K  FTI+PGSEQIRATI RDG   V   +GG VL+N+CGPCIGQ
Sbjct: 368  RSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQVLRDVGGIVLANACGPCIGQ 427

Query: 1437 WKRTDVPKGEANSIITSFNRNFAARNDGNPATHCFVASPELVTAYAIAGDLTFNPEKDTL 1616
            W R D+ KGE N+I+TS+NRNF  RND NP TH FV SPE+VTA AIAG L FNPE D L
Sbjct: 428  WDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDFL 487

Query: 1617 VGADGKEIKLEAPHGDELPSRGFDAGANVYQAPP 1718
             G DGK+ KLEAP  DELP   FD G + YQ PP
Sbjct: 488  TGKDGKKFKLEAPDADELPRAEFDPGQDTYQHPP 521

 Score =  176 bits (446), Expect(3) = 0.0
 Identities = 90/136 (66%), Positives = 104/136 (76%)
 Frame = +2

Query: 128 KVPMSQFEPHEYLNDRYKAIEDRLKVVRKRLNKPMTLAEKVVYGHLDDPENAEMKRGVSY 307
           KV MS FEPHEY+  RY  +E  + +VRKRLN+P+TL+EK+VYGHLDDP N E++RG +Y
Sbjct: 4   KVAMSHFEPHEYI--RYDLLEKNIDIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKTY 61

Query: 308 LRLRPDRVAMQDATAQMAMLQFISSGLPKTMVPSTIHCDHLIEGTTSPQPDREGKFGGEA 487
           LRLRPDRVAMQDATAQMAMLQFISSGLPK  VPSTIHCDHLI          E + GGE 
Sbjct: 62  LRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLI----------EAQLGGEK 111

Query: 488 DLSFAVKSNKEVYDFL 535
           DL  A   N+EVY+FL
Sbjct: 112 DLRRAKDINQEVYNFL 127

 Score =  146 bits (369), Expect(3) = 0.0
 Identities = 69/95 (72%), Positives = 77/95 (80%)
 Frame = +2

Query: 1778 LQLLSPFKAWNGDDIKDAAVLIKVKGKCTTDHISMAGPWLKYRGHLDNISNNLLIGAINI 1957
            LQLL PF  W+G D++D  +LIKVKGKCTTDHIS AGPWLK+RGHLDNISNNLLIGAINI
Sbjct: 538  LQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINI 597

Query: 1958 ENGKPNAVKNVVTGAEGPVPATARDYKARGLPWVV 2062
            EN K N+V+N VT   GPVP TAR YK  G+ WVV
Sbjct: 598  ENRKANSVRNAVTQEFGPVPDTARYYKQHGIRWVV 632

>pdb|5ACN|   Aconitase (E.C.4.2.1.3) (Inactive (3fe-4s) Cluster Form)
            gi|231188|pdb|6ACN|  Aconitase (E.C.4.2.1.3) (Activated
            (4fe-4s) Cluster Form) gi|443544|pdb|7ACN|  Aconitase
            (E.C.4.2.1.3) Complex With Isocitrate
          Length = 754

 Score =  602 bits (1551), Expect(3) = 0.0
 Identities = 285/394 (72%), Positives = 322/394 (81%)
 Frame = +3

Query: 537  ATAGSKYGVGFWRPGSGIIHQIVLENYALPGLMMIGTDSHTPNAGGLGMCAVGVGGADAV 716
            ATAG+KYGVGFWRPGSGIIHQI+LENYA PG+++IGTDSHTPN GGLG   +GVGGADAV
Sbjct: 128  ATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAV 187

Query: 717  DVMAGLPWELKAPKVIGVKLTGKMSRWTSPKDVILKVAGILTVKGGTGAIVEYFGPGVDH 896
            DVMAG+PWELK PKVIGVKLTG +S WTSPKDVILKVAGILTVKGGTGAIVEY GPGVD 
Sbjct: 188  DVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDS 247

Query: 897  MSCTGMATVCNMGAEIGATTSMFPYNKRMHDYLVATGRAPAASLADSFKEHLKADEGAQY 1076
            +SCTGMAT+CNMGAEIGATTS+FPYN RM  YL  TGRA  A+LAD FK+HL  D G  Y
Sbjct: 248  ISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFKDHLVPDPGCHY 307

Query: 1077 DQLIEINLSELEPHVNGPFTPDLAHPLSKFAEEMRKNGWPTELKAGLIGSCTNSSYEDMA 1256
            DQ+IEINLSEL+PH+NGPFTPDLAHP+++      K GWP +++ GLIGSCTNSSYEDM 
Sbjct: 308  DQVIEINLSELKPHINGPFTPDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMG 367

Query: 1257 RAASVARQALAAGIKAKVPFTISPGSEQIRATIARDGIMDVFDKIGGTVLSNSCGPCIGQ 1436
            R+A+VA+QALA G+K K  FTI+PGSEQIRATI RDG   V   +GG VL+N+CGPCIGQ
Sbjct: 368  RSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQVLRDVGGIVLANACGPCIGQ 427

Query: 1437 WKRTDVPKGEANSIITSFNRNFAARNDGNPATHCFVASPELVTAYAIAGDLTFNPEKDTL 1616
            W R D+ KGE N+I+TS+NRNF  RND NP TH FV SPE+VTA AIAG L FNPE D L
Sbjct: 428  WDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDFL 487

Query: 1617 VGADGKEIKLEAPHGDELPSRGFDAGANVYQAPP 1718
             G DGK+ KLEAP  DELP   FD G + YQ PP
Sbjct: 488  TGKDGKKFKLEAPDADELPRAEFDPGQDTYQHPP 521

 Score =  176 bits (446), Expect(3) = 0.0
 Identities = 90/136 (66%), Positives = 104/136 (76%)
 Frame = +2

Query: 128 KVPMSQFEPHEYLNDRYKAIEDRLKVVRKRLNKPMTLAEKVVYGHLDDPENAEMKRGVSY 307
           KV MS FEPHEY+  RY  +E  + +VRKRLN+P+TL+EK+VYGHLDDP N E++RG +Y
Sbjct: 4   KVAMSHFEPHEYI--RYDLLEKNIDIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKTY 61

Query: 308 LRLRPDRVAMQDATAQMAMLQFISSGLPKTMVPSTIHCDHLIEGTTSPQPDREGKFGGEA 487
           LRLRPDRVAMQDATAQMAMLQFISSGLPK  VPSTIHCDHLI          E + GGE 
Sbjct: 62  LRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLI----------EAQLGGEK 111

Query: 488 DLSFAVKSNKEVYDFL 535
           DL  A   N+EVY+FL
Sbjct: 112 DLRRAKDINQEVYNFL 127

 Score =  146 bits (369), Expect(3) = 0.0
 Identities = 69/95 (72%), Positives = 77/95 (80%)
 Frame = +2

Query: 1778 LQLLSPFKAWNGDDIKDAAVLIKVKGKCTTDHISMAGPWLKYRGHLDNISNNLLIGAINI 1957
            LQLL PF  W+G D++D  +LIKVKGKCTTDHIS AGPWLK+RGHLDNISNNLLIGAINI
Sbjct: 538  LQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINI 597

Query: 1958 ENGKPNAVKNVVTGAEGPVPATARDYKARGLPWVV 2062
            EN K N+V+N VT   GPVP TAR YK  G+ WVV
Sbjct: 598  ENRKANSVRNAVTQEFGPVPDTARYYKQHGIRWVV 632

>pdb|1C97|A Chain A, S642a:isocitrate Complex Of Aconitase gi|6729979|pdb|1B0K|A
            Chain A, S642a:fluorocitrate Complex Of Aconitase
          Length = 753

 Score =  602 bits (1551), Expect(3) = 0.0
 Identities = 285/394 (72%), Positives = 322/394 (81%)
 Frame = +3

Query: 537  ATAGSKYGVGFWRPGSGIIHQIVLENYALPGLMMIGTDSHTPNAGGLGMCAVGVGGADAV 716
            ATAG+KYGVGFWRPGSGIIHQI+LENYA PG+++IGTDSHTPN GGLG   +GVGGADAV
Sbjct: 127  ATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAV 186

Query: 717  DVMAGLPWELKAPKVIGVKLTGKMSRWTSPKDVILKVAGILTVKGGTGAIVEYFGPGVDH 896
            DVMAG+PWELK PKVIGVKLTG +S WTSPKDVILKVAGILTVKGGTGAIVEY GPGVD 
Sbjct: 187  DVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDS 246

Query: 897  MSCTGMATVCNMGAEIGATTSMFPYNKRMHDYLVATGRAPAASLADSFKEHLKADEGAQY 1076
            +SCTGMAT+CNMGAEIGATTS+FPYN RM  YL  TGRA  A+LAD FK+HL  D G  Y
Sbjct: 247  ISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFKDHLVPDPGCHY 306

Query: 1077 DQLIEINLSELEPHVNGPFTPDLAHPLSKFAEEMRKNGWPTELKAGLIGSCTNSSYEDMA 1256
            DQ+IEINLSEL+PH+NGPFTPDLAHP+++      K GWP +++ GLIGSCTNSSYEDM 
Sbjct: 307  DQVIEINLSELKPHINGPFTPDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMG 366

Query: 1257 RAASVARQALAAGIKAKVPFTISPGSEQIRATIARDGIMDVFDKIGGTVLSNSCGPCIGQ 1436
            R+A+VA+QALA G+K K  FTI+PGSEQIRATI RDG   V   +GG VL+N+CGPCIGQ
Sbjct: 367  RSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQVLRDVGGIVLANACGPCIGQ 426

Query: 1437 WKRTDVPKGEANSIITSFNRNFAARNDGNPATHCFVASPELVTAYAIAGDLTFNPEKDTL 1616
            W R D+ KGE N+I+TS+NRNF  RND NP TH FV SPE+VTA AIAG L FNPE D L
Sbjct: 427  WDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDFL 486

Query: 1617 VGADGKEIKLEAPHGDELPSRGFDAGANVYQAPP 1718
             G DGK+ KLEAP  DELP   FD G + YQ PP
Sbjct: 487  TGKDGKKFKLEAPDADELPRAEFDPGQDTYQHPP 520

 Score =  176 bits (446), Expect(3) = 0.0
 Identities = 90/136 (66%), Positives = 104/136 (76%)
 Frame = +2

Query: 128 KVPMSQFEPHEYLNDRYKAIEDRLKVVRKRLNKPMTLAEKVVYGHLDDPENAEMKRGVSY 307
           KV MS FEPHEY+  RY  +E  + +VRKRLN+P+TL+EK+VYGHLDDP N E++RG +Y
Sbjct: 3   KVAMSHFEPHEYI--RYDLLEKNIDIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKTY 60

Query: 308 LRLRPDRVAMQDATAQMAMLQFISSGLPKTMVPSTIHCDHLIEGTTSPQPDREGKFGGEA 487
           LRLRPDRVAMQDATAQMAMLQFISSGLPK  VPSTIHCDHLI          E + GGE 
Sbjct: 61  LRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLI----------EAQLGGEK 110

Query: 488 DLSFAVKSNKEVYDFL 535
           DL  A   N+EVY+FL
Sbjct: 111 DLRRAKDINQEVYNFL 126

 Score =  146 bits (369), Expect(3) = 0.0
 Identities = 69/95 (72%), Positives = 77/95 (80%)
 Frame = +2

Query: 1778 LQLLSPFKAWNGDDIKDAAVLIKVKGKCTTDHISMAGPWLKYRGHLDNISNNLLIGAINI 1957
            LQLL PF  W+G D++D  +LIKVKGKCTTDHIS AGPWLK+RGHLDNISNNLLIGAINI
Sbjct: 537  LQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINI 596

Query: 1958 ENGKPNAVKNVVTGAEGPVPATARDYKARGLPWVV 2062
            EN K N+V+N VT   GPVP TAR YK  G+ WVV
Sbjct: 597  ENRKANSVRNAVTQEFGPVPDTARYYKQHGIRWVV 631



EST assemble image


clone accession position
1 HCL081b05_r AV644068 1 565
2 HCL076d05_r AV643806 3 577
3 HCL078d06_r AV643918 13 606
4 MXL080e07_r BP097735 17 493
5 LCL083a02_r AV630705 86 449
6 HCL023g09_r AV640868 91 598
7 LCL098c04_r AV631688 95 481
8 MXL018c09_r BP094109 96 546
9 HCL015h05_r AV640416 99 336
10 HCL039c05_r AV641717 99 617
11 CL74f12_r AV396501 100 672
12 HCL039f07_r AV641742 103 551
13 LCL040g02_r AV628372 103 532
14 LCL014h03_r AV626751 105 421
15 CL46h01_r AV395650 105 627
16 LCL001f07_r AV626046 105 617
17 HCL048e07_r AV642258 105 314
18 HCL055g11_r AV642672 105 608
19 HCL012c09_r AV640214 105 271
20 MXL066b04_r BP096868 105 516
21 LCL072g07_r AV630086 105 436
22 MXL032a09_r BP094903 105 629
23 LCL008c04_r AV626386 105 596
24 LCL067h08_r AV629865 105 580
25 LCL050d07_r AV629014 105 547
26 LCL056f02_r AV629324 105 598
27 LCL005c01_r AV626254 105 554
28 LCL039a02_r AV628239 105 557
29 LCL078b01_r AV630384 105 557
30 HCL047e11_r AV642212 105 424
31 HCL035a02_r AV641508 105 578
32 HCL087h06_r AV644402 106 585
33 MXL007a09_r BP093336 106 580
34 HCL091a06_r AV644592 106 543
35 HCL077c09_r AV643859 106 596
36 CL53b09_r AV395998 106 553
37 HCL066d06_r AV643252 106 576
38 LCL093d03_r AV631409 106 454
39 HCL008h04_r AV640017 106 595
40 MXL059b08_r BP096463 107 602
41 LCL061e06_r AV629587 107 533
42 HCL020h10_r AV640700 108 406
43 HCL006b09_r AV639854 109 533
44 LCL095a06_r AV631495 109 580
45 HCL066a02_r AV643227 110 602
46 CL11d07_r AV393789 110 634
47 HCL054g03_r AV642613 110 519
48 HCL028d06_r AV641139 110 533
49 CL02a02_r AV397582 111 684
50 CL45g01_r AV397784 111 628
51 MXL063c05_r BP096694 111 485
52 HCL049a01_r AV642283 112 639
53 HCL020h01_r AV640694 112 292
54 HCL045g07_r AV642108 114 436
55 CL31d02_r AV395025 115 646
56 HCL052c05_r AV642462 115 625
57 HCL040e07_r AV641803 115 656
58 HCL076b03_r AV643790 115 621
59 MXL082f02_r BP097866 115 485
60 MXL003b03_r BP093080 115 437
61 HCL067d11_r AV643315 115 604
62 HCL082c05_r AV644117 116 599
63 LCL009e04_r AV626461 117 409
64 HCL094e06_r AV644841 117 543
65 MXL078g04_r BP097631 118 510
66 MXL047h08_r BP095820 118 632
67 MXL074e05_r BP097365 118 534
68 HCL059e09_r AV642867 122 614
69 HCL010g08_r AV640124 123 399
70 HCL018c08_r AV640558 123 607
71 CL19c07_r AV394187 123 672
72 CL54c05_r AV396172 123 572
73 MXL077c12_r BP097528 126 306
74 CL60a12_r AV396354 126 680
75 CL45c08_r AV397793 126 681
76 CL12b02_r AV393813 126 678
77 HCL049g11_r AV642329 126 595
78 HCL017f06_r AV640513 129 650
79 CL33h03_r AV394984 129 654
80 LCL014b04_r AV626712 129 436
81 CL64f03_r AV396641 129 692
82 MXL047f09_r BP095806 132 580
83 LCL041e04_r AV628420 133 450
84 HCL035f01_r AV641530 137 629
85 HCL089e06_r AV644495 139 621
86 MXL087c09_r BP098112 151 522
87 LCL077d12_r AV630335 187 606
88 HCL078h01_r AV643942 235 739
89 HCL006b12_r AV639856 236 679
90 HCL061d03_r AV642966 251 764
91 MXL056a12_r BP096292 267 707
92 HCL052a02_r AV642448 271 787
93 MXL066b12_r BP096872 274 609
94 HCL084e03_r AV644235 307 798
95 MXL038c01_r BP095218 401 789
96 LCL099e11_r AV631772 539 1042
97 MXL098a11_r BP098727 582 908
98 MXL064a12_r BP096740 583 864
99 MXL091b12_r BP098304 832 1231
100 MXL042c04_r BP095466 1119 1548
101 MXL052d07_r BP096087 1189 1599
102 CM027d10_r AV387606 1317 1903
103 MXL049f05_r BP095933 1419 1833
104 HC048a03_r AV635569 1475 1992
105 HC032h03_r AV634398 1640 1957
106 LC085b10_r AV624970 1686 2126
107 MX251h04_r BP092271 1736 2100
108 MX205f07_r BP089354 1816 2182
109 MX228c04_r BP090732 1965 2149




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research