KCC000036A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000036A_C01 KCC000036A_c01
AGAGAGCGCACTCAAAGTTGCTGTTTGTCGGCCGGGGTCTTCGAAGTTGCACCACTTACG
GAGCACGTTATCGGGACGCTGCAATTCATGTAATCCTATATAACTTCTACTTGCAAGCTG
CCGAACAAACACACGATTAGTGAGGGACAAGGAGGGAATTCTTTCGCGGCATTCCGCGAG
GTGCAAGCCAGCAGCACGTGCGAGTAGCAACCACCAAGAGCACGCTCGCAGCTTGACATC
ATGGGTGATCGGCCTGGGAGTCCAGGCCGCCCTGGGACAAGTCAGGGCGGTCCTCGCTTG
AGAGGCCGGTCCGACGCTCTCGTGACCGTGGCGAACCGCCTGCGGAGCCCGATGTACATC
AGCGATCGGGCGCTTCCCCCAGAGGACGTGACAGTTAACACTATCGAGAGCCTGCTGCGC
ATTCCCAACCTGGCCTCGGGGCGCACTGAGGAGCAGCTGGTGGCGGCCTTCAGCGGngat
gac


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000036A_C01 KCC000036A_c01
         (483 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_034221.1| dishevelled, dsh homolog 1; dishevelled, dsh ho...    35  0.61
ref|ZP_00081371.1| COG0178: Excinuclease ATPase subunit [Geobact...    35  0.61
sp|P51141|DVL1_MOUSE Segment polarity protein dishevelled homolo...    35  0.61
ref|NP_711039.1| Fimh-like protein [Leptospira interrogans serov...    34  1.0
dbj|BAB14131.1| unnamed protein product [Homo sapiens]                 33  1.4

>ref|NP_034221.1| dishevelled, dsh homolog 1; dishevelled, dsh homolog (Drosophila)
           [Mus musculus] gi|930347|gb|AAA74049.1| dishevelled-1
           protein [Mus musculus]
          Length = 691

 Score = 34.7 bits (78), Expect = 0.61
 Identities = 23/74 (31%), Positives = 30/74 (40%)
 Frame = -3

Query: 466 PPPAAPQCAPRPGWECAAGSR*C*LSRPLGEAPDR*CTSGSAGGSPRSRERRTGLSSEDR 287
           PPP  P     PG+ C +GS           A  +      + GS RS  R  G   E+R
Sbjct: 541 PPPCFPPAYQDPGFSCGSGS-----------AGSQQSEGSKSSGSTRSSHRTPG--REER 587

Query: 286 PDLSQGGLDSQADH 245
                GG  S++DH
Sbjct: 588 RATGAGGSGSESDH 601

>ref|ZP_00081371.1| COG0178: Excinuclease ATPase subunit [Geobacter metallireducens]
          Length = 1710

 Score = 34.7 bits (78), Expect = 0.61
 Identities = 26/71 (36%), Positives = 31/71 (43%), Gaps = 13/71 (18%)
 Frame = +3

Query: 267  PPWDKSGRSSLERPVRRSRDR--GEPPAEPDVHQ-----------RSGASPRGRDS*HYR 407
            PP    GR  L  P  R R R  GE    P   +           R G+  RGR S ++R
Sbjct: 1578 PPQPARGRRRLPAPAARLRHRRLGERQEHPGAQRPPLLHPGAPGPRQGSPYRGRVSGNHR 1637

Query: 408  EPAAHSQPGLG 440
              AAHS+PG G
Sbjct: 1638 VGAAHSRPGGG 1648

>sp|P51141|DVL1_MOUSE Segment polarity protein dishevelled homolog DVL-1 (Dishevelled-1)
           (DSH homolog 1) gi|497690|gb|AAA82175.1| similar to
           Drosophila dishevelled segment polarity gene, GenBank
           Accession Number U02491
          Length = 695

 Score = 34.7 bits (78), Expect = 0.61
 Identities = 23/74 (31%), Positives = 30/74 (40%)
 Frame = -3

Query: 466 PPPAAPQCAPRPGWECAAGSR*C*LSRPLGEAPDR*CTSGSAGGSPRSRERRTGLSSEDR 287
           PPP  P     PG+ C +GS           A  +      + GS RS  R  G   E+R
Sbjct: 545 PPPCFPPAYQDPGFSCGSGS-----------AGSQQSEGSKSSGSTRSSHRTPG--REER 591

Query: 286 PDLSQGGLDSQADH 245
                GG  S++DH
Sbjct: 592 RATGAGGSGSESDH 605

>ref|NP_711039.1| Fimh-like protein [Leptospira interrogans serovar lai str. 56601]
           gi|24194344|gb|AAN48057.1|AE011270_11 Fimh-like protein
           [Leptospira interrogans serovar lai str. 56601]
          Length = 407

 Score = 33.9 bits (76), Expect = 1.0
 Identities = 30/122 (24%), Positives = 47/122 (37%), Gaps = 4/122 (3%)
 Frame = +1

Query: 13  QSCCL----SAGVFEVAPLTEHVIGTLQFM*SYITSTCKLPNKHTISEGQGGNSFAAFRE 180
           Q C L    S G F   P   + +G  Q         CK  + +TI +   G ++ A  +
Sbjct: 91  QDCALVLPGSDGSFSNVPNARNFVGPTQH--------CKFTSDYTIFDPLHGLTWKACAQ 142

Query: 181 VQASSTCE*QPPRARSQLDIMGDRPGSPGRPGTSQGGPRLRGRSDALVTVANRLRSPMYI 360
            Q  S C        +  D+    PGS     T  GG    GR++  +  A  L S ++ 
Sbjct: 143 GQTGSDCAGGVVVPMNWADVNAGLPGSCAELNTLNGGEGYAGRTNWRIPAARELASIVHY 202

Query: 361 SD 366
           ++
Sbjct: 203 TN 204

>dbj|BAB14131.1| unnamed protein product [Homo sapiens]
          Length = 287

 Score = 33.5 bits (75), Expect = 1.4
 Identities = 21/56 (37%), Positives = 25/56 (44%)
 Frame = +3

Query: 177 RGASQQHVRVATTKSTLAA*HHG*SAWESRPPWDKSGRSSLERPVRRSRDRGEPPA 344
           RG SQ     AT  S  AA   G   W SR P  +S  SS E P   +    +PP+
Sbjct: 138 RGPSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPS 193



EST assemble image


clone accession position
1 CL60b12_r AV396355 1 503
2 LCL062c04_r AV629626 71 579
3 HCL036a02_r AV641547 72 468
4 CL25c04_r AV394522 89 569
5 HCL063b01_r AV643063 105 262
6 CL01h11_r AV393303 121 457




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research