KCC000035A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000035A_C02 KCC000035A_c02
CAAAAATGGCCGAGCGCAAGACCACGGATATGCGGGAGATCCGCATCAGCAAGCTGGTGC
TGAACATCGCCGTCGGCGAGTCCGGTGACCGCCTGCAGAAGGCCGCCAAGGTGCTGGAGC
AGCTGACCTCTCAGGTGCCCGTCTACGGCCGCGCTCGCTTCACCGTGCGCTCCTTCGCCA
TTCGCCGTAATGAGAAGATTTCGTGCTACGTGACCGTCCGCGGCGAGAAGGCCTACGACC
TGGTGAAGCGTGGCCTGGCCGTGAAGGAGTTCGAGCTGATCCGCAAGAACTTCTCCGACA
CCGGCAACTTCGGCTTCGGCATCCAGGAGCACATCGACCTGGGCCTGAAGTACGACCCCT
CCACCGGCATTTACGGCATGGACTTCTACGTGTGCCTGGAGCGCCGCGGCTACCGCGTGG
CCCGCCGCCGGAAGCAGAAGGCCCACGTGGGCGTCAAGCACAAGGTGACCAAGGAGGACG
CCATCAAGTGGTTCCAGCAGGAGTTCGACGGCGTCGTCCTCAACAAGGCGCCCGCCTCGT
AAAGCGGCCACAAGAGGCTGGTGATGACAGATGCCACCCCATCTGTGTAACAAGTCctga
ccccaaaaa


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000035A_C02 KCC000035A_c02
         (609 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P50881|RL11_CHLRE 60S RIBOSOMAL PROTEIN L11 gi|7440679|pir||T...   337  8e-92
dbj|BAA92964.1| unnamed protein product [Oryza sativa (japonica ...   266  2e-70
emb|CAD56220.1| ribosomal protein RL5 [Cicer arietinum]               264  7e-70
sp|P42795|R111_ARATH 60S ribosomal protein L11-1 (L16A)               263  1e-69
ref|NP_850376.1| 60S ribosomal protein L11 (RPL11A) [Arabidopsis...   263  2e-69

>sp|P50881|RL11_CHLRE 60S RIBOSOMAL PROTEIN L11 gi|7440679|pir||T08155 ribosomal protein
           L11 - Chlamydomonas reinhardtii
           gi|1167826|emb|CAA64625.1| 60S ribosomal protein L11
           [Chlamydomonas reinhardtii]
          Length = 170

 Score =  337 bits (864), Expect = 8e-92
 Identities = 169/170 (99%), Positives = 169/170 (99%)
 Frame = +3

Query: 30  MREIRISKLVLNIAVGESGDRLQKAAKVLEQLTSQVPVYGRARFTVRSFAIRRNEKISCY 209
           MREIRISKLVLNIAV ESGDRLQKAAKVLEQLTSQVPVYGRARFTVRSFAIRRNEKISCY
Sbjct: 1   MREIRISKLVLNIAVAESGDRLQKAAKVLEQLTSQVPVYGRARFTVRSFAIRRNEKISCY 60

Query: 210 VTVRGEKAYDLVKRGLAVKEFELIRKNFSDTGNFGFGIQEHIDLGLKYDPSTGIYGMDFY 389
           VTVRGEKAYDLVKRGLAVKEFELIRKNFSDTGNFGFGIQEHIDLGLKYDPSTGIYGMDFY
Sbjct: 61  VTVRGEKAYDLVKRGLAVKEFELIRKNFSDTGNFGFGIQEHIDLGLKYDPSTGIYGMDFY 120

Query: 390 VCLERRGYRVARRRKQKAHVGVKHKVTKEDAIKWFQQEFDGVVLNKAPAS 539
           VCLERRGYRVARRRKQKAHVGVKHKVTKEDAIKWFQQEFDGVVLNKAPAS
Sbjct: 121 VCLERRGYRVARRRKQKAHVGVKHKVTKEDAIKWFQQEFDGVVLNKAPAS 170

>dbj|BAA92964.1| unnamed protein product [Oryza sativa (japonica cultivar-group)]
          Length = 182

 Score =  266 bits (679), Expect = 2e-70
 Identities = 125/176 (71%), Positives = 156/176 (88%)
 Frame = +3

Query: 12  ERKTTDMREIRISKLVLNIAVGESGDRLQKAAKVLEQLTSQVPVYGRARFTVRSFAIRRN 191
           +++   MREI++ KLVLNI+VGESGDRL +A+KVLEQL+ Q PV+ +AR+TVRSF IRRN
Sbjct: 5   KKQANPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGIRRN 64

Query: 192 EKISCYVTVRGEKAYDLVKRGLAVKEFELIRKNFSDTGNFGFGIQEHIDLGLKYDPSTGI 371
           EKI+CYVTVRGEKA  L++ GL VKE+EL+R+NFS+TG FGFGIQEHIDLG+KYDPSTGI
Sbjct: 65  EKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPSTGI 124

Query: 372 YGMDFYVCLERRGYRVARRRKQKAHVGVKHKVTKEDAIKWFQQEFDGVVLNKAPAS 539
           YGMDFYV LER GYRVARRR+ K+ VG++H+VTKEDA+KWFQ +++GV+LNKA A+
Sbjct: 125 YGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKYEGVILNKAQAN 180

>emb|CAD56220.1| ribosomal protein RL5 [Cicer arietinum]
          Length = 181

 Score =  264 bits (675), Expect = 7e-70
 Identities = 126/177 (71%), Positives = 157/177 (88%), Gaps = 1/177 (0%)
 Frame = +3

Query: 9   AERKTTD-MREIRISKLVLNIAVGESGDRLQKAAKVLEQLTSQVPVYGRARFTVRSFAIR 185
           +E+K ++ MREI++ KLVLNI+VGESGDRL +AAKVLEQL+ Q PV+ +AR+TVRSF IR
Sbjct: 3   SEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIR 62

Query: 186 RNEKISCYVTVRGEKAYDLVKRGLAVKEFELIRKNFSDTGNFGFGIQEHIDLGLKYDPST 365
           RNEKI+CYVTVRG+KA  L++ GL VKE+EL+R+NFSDTG FGFGIQEHIDLG+KYDPST
Sbjct: 63  RNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST 122

Query: 366 GIYGMDFYVCLERRGYRVARRRKQKAHVGVKHKVTKEDAIKWFQQEFDGVVLNKAPA 536
           GIYGMDFYV LER GYRV RRR+ KA VG++H+VTK+DA+KWFQ +++GV+LNK+ A
Sbjct: 123 GIYGMDFYVVLERPGYRVGRRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKSQA 179

>sp|P42795|R111_ARATH 60S ribosomal protein L11-1 (L16A)
          Length = 182

 Score =  263 bits (673), Expect = 1e-69
 Identities = 125/175 (71%), Positives = 157/175 (89%), Gaps = 1/175 (0%)
 Frame = +3

Query: 9   AERKTTD-MREIRISKLVLNIAVGESGDRLQKAAKVLEQLTSQVPVYGRARFTVRSFAIR 185
           +E+K ++ MR+I++ KLVLNI+VGESGDRL +A+KVLEQL+ Q PV+ +AR+TVRSF IR
Sbjct: 3   SEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIR 62

Query: 186 RNEKISCYVTVRGEKAYDLVKRGLAVKEFELIRKNFSDTGNFGFGIQEHIDLGLKYDPST 365
           RNEKI+CYVTVRGEKA  L++ GL VKE+EL+R+NFSDTG FGFGIQEHIDLG+KYDPST
Sbjct: 63  RNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPST 122

Query: 366 GIYGMDFYVCLERRGYRVARRRKQKAHVGVKHKVTKEDAIKWFQQEFDGVVLNKA 530
           GIYGMDFYV LER GYRVARRR+ KA VG++H+VTK+DA+KWFQ +++GV+LNK+
Sbjct: 123 GIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKS 177

>ref|NP_850376.1| 60S ribosomal protein L11 (RPL11A) [Arabidopsis thaliana]
           gi|18491255|gb|AAL69452.1| At2g42740/F7D19.26
           [Arabidopsis thaliana]
          Length = 172

 Score =  263 bits (671), Expect = 2e-69
 Identities = 123/167 (73%), Positives = 151/167 (89%)
 Frame = +3

Query: 30  MREIRISKLVLNIAVGESGDRLQKAAKVLEQLTSQVPVYGRARFTVRSFAIRRNEKISCY 209
           MR+I++ KLVLNI+VGESGDRL +A+KVLEQL+ Q PV+ +AR+TVRSF IRRNEKI+CY
Sbjct: 1   MRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACY 60

Query: 210 VTVRGEKAYDLVKRGLAVKEFELIRKNFSDTGNFGFGIQEHIDLGLKYDPSTGIYGMDFY 389
           VTVRGEKA  L++ GL VKE+EL+R+NFSDTG FGFGIQEHIDLG+KYDPSTGIYGMDFY
Sbjct: 61  VTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFY 120

Query: 390 VCLERRGYRVARRRKQKAHVGVKHKVTKEDAIKWFQQEFDGVVLNKA 530
           V LER GYRVARRR+ KA VG++H+VTK+DA+KWFQ +++GV+LNK+
Sbjct: 121 VVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILNKS 167



EST assemble image


clone accession position
1 MX020d06_r BP086922 1 537
2 CL65c06_r AV396599 14 667
3 CL44f04_r AV395621 15 577
4 MXL041b02_r BP095390 15 618
5 CL29d03_r AV394636 19 680
6 CL62e07_r AV396417 19 700
7 CL17f04_r AV394123 23 663
8 CL12b11_r AV393823 91 609
9 MXL001a11_r BP092936 94 503
10 CL37f07_r AV395221 95 651
11 LCL089g06_r AV631166 95 608
12 MX060h07_r BP088456 95 573
13 MXL002b03_r BP093010 95 641
14 HC043f10_r AV635235 95 676
15 LCL100e03_r AV631828 97 643
16 MXL078e07_r BP097615 98 576
17 CM065a12_r AV391096 98 763
18 HC047b11_r AV635504 98 606
19 MXL025c07_r BP094584 98 608
20 CM092c07_r AV392690 98 559
21 CL63e12_r AV396528 98 678
22 CL05h05_r AV393566 101 639
23 HCL096b04_r AV644966 102 541
24 MX053d07_r BP088178 102 493
25 CL32c10_r AV394845 103 658
26 CM020b01_r AV397495 103 757
27 CL03c06_r AV393401 104 674
28 CL45c06_r AV397777 105 646
29 MXL001g11_r BP092987 105 662
30 CM025g11_r AV388114 105 766
31 MX032h10_r BP087356 105 522
32 MX228g04_r BP090759 105 562
33 CL67g09_r AV396705 106 686
34 CL56d05_r AV396079 106 654
35 MXL003d09_r BP093104 106 553
36 MX010e04_r BP086512 106 556
37 CM005h04_r AV386877 106 555
38 CL25e09_r AV394550 106 656
39 MX009d07_r BP086464 106 578
40 CL73e06_r AV397000 106 615
41 CM057a01_r AV390463 106 683
42 CL44b04_r AV395618 106 613
43 CL44f02_r AV395589 106 612
44 CL40h07_r AV395375 106 612
45 CM022f01_r AV387847 106 646
46 CS001f02_r AV397981 106 664
47 CL42h11_r AV395483 106 608
48 CL03g09_r AV393419 106 650
49 CS001f03_r AV397958 106 667
50 CL46g05_r AV395658 106 670
51 HC008a05_r AV632419 106 675
52 CL37d05_r AV395265 106 673
53 CL19e04_r AV394178 106 647
54 CL75f02_r AV397070 106 682
55 CL30g12_r AV394760 106 683
56 CL70h10_r AV396867 106 683
57 CL14c06_r AV393878 106 635
58 CS001g12_r AV397973 106 709
59 CL66b10_r AV396748 106 729
60 CM076h01_r AV391678 106 788
61 MX219g06_r BP090157 106 460
62 CL33a10_r AV394951 106 634
63 CL73h05_r AV396972 106 632
64 MXL017h05_r BP094081 106 497
65 MXL037a03_r BP095168 106 541
66 CL52f10_r AV395876 106 675
67 CL08d07_r AV393515 106 639
68 CL52h09_r AV395871 106 693
69 CL55f02_r AV396052 106 743
70 HCL074h07_r AV643724 106 664
71 CL09h03_r AV393739 106 554
72 CL52b01_r AV395865 106 628
73 CL31g05_r AV395048 106 700
74 MXL099d02_r BP098801 106 518
75 CL51d03_r AV395941 106 542
76 CL50g05_r AV395737 107 645
77 CL79h02_r AV397175 107 493
78 CL36e11_r AV395164 107 675
79 CL50h10_r AV395765 107 659
80 CL58e03_r AV396199 107 675
81 CL64b07_r AV396640 108 685
82 CM063b12_r AV390079 109 777
83 CL21b11_r AV394368 109 670
84 CL13g06_r AV393912 109 665
85 CL62f03_r AV396412 109 675
86 CL10b01_r AV393669 109 661
87 CL22d09_r AV394267 110 586
88 MXL035b02_r BP095055 110 604
89 CL30b06_r AV394743 110 637
90 CL37f01_r AV395257 111 504
91 CL28e06_r AV394798 111 626
92 CL01h09_r AV393332 111 674
93 CL41e05_r AV395402 113 511
94 CL14e08_r AV393861 115 669
95 CM074a12_r AV391547 116 696
96 CL48e11_r AV395834 116 677
97 HCL099e07_r AV645202 118 523
98 CL59h03_r AV397893 120 721
99 CL25b05_r AV394516 120 637
100 CL40c01_r AV395336 128 689
101 CL43d11_r AV395530 128 666
102 CL67g07_r AV396675 131 727
103 CL25g12_r AV394564 133 729
104 CL46b12_r AV395666 133 673
105 CL69c11_r AV396792 135 647
106 CL23b07_r AV394476 140 686
107 CL14c05_r AV393887 147 705
108 HCL010e01_r AV640103 149 439
109 CL20f05_r AV394316 166 657
110 CL30f08_r AV394755 173 660
111 CL48c05_r AV395784 175 751
112 CL38e04_r AV395302 176 727
113 CL62d11_r AV396448 180 689
114 CL59d10_r AV397930 199 762
115 CL67d11_r AV396719 200 757
116 CL37c01_r AV395248 203 757
117 CL39f03_r AV395186 204 752
118 CL56e03_r AV396091 212 743
119 CL71g08_r AV396882 222 782
120 CM076a05_r AV391674 232 763
121 CL72d08_r AV397019 258 749
122 CL39c12_r AV395209 262 744
123 MX207d12_r BP089445 265 757
124 HCL094g09_r AV644862 296 671
125 CM047e12_r AV388604 302 599
126 MXL037f03_r BP095191 304 789
127 CM022a09_r AV387870 392 727
128 HCL095f03_r AV644926 446 764




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research