KCC000034A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000034A_C01 KCC000034A_c01
TCACCATGCCGCCGAAGTTTGACCCCAGTGATGTGGTGGAGGTGTGCGTGCGTGTGACCG
GTGGTGAGGTGGGTGCCGCCTCCTCGCTGGCCCCTAAGATTGGTCCGCTGGGTCTGTCCC
CCAAGAAGATTGGTGAGGACATCGCTAAGGAGACCCTGAAGGACTGGAAGGGCCTGCGCA
TCACCGTCAAGCTCACTGTCCAGAACCGTCAGGCGAAGATTTCGGTCATTCCCTCGGCGG
CCGCGCTGGTCATCAAGGCCCTGAAGGAGCCCGCCCGCGACCGCAAGAAGGAGAAGAACA
TCAAGCACACTGGCAGCGTGACGATGTCGGACATCATCGAGATTGCCCGCGTCATGCGGC
CGCGCAGCTGCGCCAAGGACCTGGCGAACGGCTGCAAGGAGATCCTGGGGACAGCCGTGT
CGGTCGGCTGCAAGGTGGACGGCAAGGACCCCCGCGACGTCATCTCCGCCATCGACGACG
GCGCCATCGAGATCCCCGACGCTTAAGCGCGGGGCGTGTTGCAGCGGCAGGGAAGAGCAG
CTGATGATGATCAAGGGTGTGCTGTAACGTCTGTGCGAAGT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000034A_C01 KCC000034A_c01
         (581 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P50884|RL12_CHLRE 60S RIBOSOMAL PROTEIN L12 gi|7440807|pir||T...   304  7e-82
emb|CAE03942.1| OSJNBa0093F12.16 [Oryza sativa (japonica cultiva...   261  4e-69
ref|NP_181256.1| 60S ribosomal protein L12 (RPL12A) [Arabidopsis...   257  7e-68
sp|O50003|RL12_PRUAR 60S RIBOSOMAL PROTEIN L12 gi|2677830|gb|AAB...   255  3e-67
ref|NP_190911.1| 60S ribosomal protein L12 (RPL12B) [Arabidopsis...   255  3e-67

>sp|P50884|RL12_CHLRE 60S RIBOSOMAL PROTEIN L12 gi|7440807|pir||T08157 ribosomal protein
           L12 - Chlamydomonas reinhardtii (fragment)
           gi|1167828|emb|CAA64626.1| 60S ribosomal protein L12
           [Chlamydomonas reinhardtii]
          Length = 157

 Score =  304 bits (778), Expect = 7e-82
 Identities = 156/157 (99%), Positives = 156/157 (99%)
 Frame = +3

Query: 33  VVEVCVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETLKDWKGLRITVKLTVQNRQ 212
           VVEVCVRVTGGEVG ASSLAPKIGPLGLSPKKIGEDIAKETLKDWKGLRITVKLTVQNRQ
Sbjct: 1   VVEVCVRVTGGEVGDASSLAPKIGPLGLSPKKIGEDIAKETLKDWKGLRITVKLTVQNRQ 60

Query: 213 AKISVIPSAAALVIKALKEPARDRKKEKNIKHTGSVTMSDIIEIARVMRPRSCAKDLANG 392
           AKISVIPSAAALVIKALKEPARDRKKEKNIKHTGSVTMSDIIEIARVMRPRSCAKDLANG
Sbjct: 61  AKISVIPSAAALVIKALKEPARDRKKEKNIKHTGSVTMSDIIEIARVMRPRSCAKDLANG 120

Query: 393 CKEILGTAVSVGCKVDGKDPRDVISAIDDGAIEIPDA 503
           CKEILGTAVSVGCKVDGKDPRDVISAIDDGAIEIPDA
Sbjct: 121 CKEILGTAVSVGCKVDGKDPRDVISAIDDGAIEIPDA 157

>emb|CAE03942.1| OSJNBa0093F12.16 [Oryza sativa (japonica cultivar-group)]
          Length = 166

 Score =  261 bits (668), Expect = 4e-69
 Identities = 129/166 (77%), Positives = 146/166 (87%)
 Frame = +3

Query: 6   MPPKFDPSDVVEVCVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETLKDWKGLRIT 185
           MPPK DP+ VV+V VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKET KDWKGLR+T
Sbjct: 1   MPPKLDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT 60

Query: 186 VKLTVQNRQAKISVIPSAAALVIKALKEPARDRKKEKNIKHTGSVTMSDIIEIARVMRPR 365
           VKLTVQNRQAK+SV+PSAAALVIKALKEP RDRKK KNIKH+G++++ D+IEIAR+MR R
Sbjct: 61  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIARIMRNR 120

Query: 366 SCAKDLANGCKEILGTAVSVGCKVDGKDPRDVISAIDDGAIEIPDA 503
           S AK++A   KEILGT VSVGC VDGKDP+D+   I DG +EIP A
Sbjct: 121 SMAKEMAGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGEVEIPSA 166

>ref|NP_181256.1| 60S ribosomal protein L12 (RPL12A) [Arabidopsis thaliana]
           gi|19884128|sp|P50883|RL12_ARATH 60S ribosomal protein
           L12 gi|25295163|pir||F84789 60S ribosomal protein L12
           [imported] - Arabidopsis thaliana
           gi|4371282|gb|AAD18140.1| 60S ribosomal protein L12
           [Arabidopsis thaliana]
           gi|13926286|gb|AAK49612.1|AF372896_1 At2g37190/T2N18.5
           [Arabidopsis thaliana] gi|21592414|gb|AAM64365.1| 60S
           ribosomal protein L12 [Arabidopsis thaliana]
           gi|27363340|gb|AAO11589.1| At2g37190/T2N18.5
           [Arabidopsis thaliana]
          Length = 166

 Score =  257 bits (657), Expect = 7e-68
 Identities = 124/165 (75%), Positives = 144/165 (87%)
 Frame = +3

Query: 6   MPPKFDPSDVVEVCVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETLKDWKGLRIT 185
           MPPK DPS +V+V VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKET K+WKGLR+T
Sbjct: 1   MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT 60

Query: 186 VKLTVQNRQAKISVIPSAAALVIKALKEPARDRKKEKNIKHTGSVTMSDIIEIARVMRPR 365
           VKLTVQNRQAK++V+PSAAALVIKALKEP RDRKK KNIKH G+++  D+ EIAR+MRPR
Sbjct: 61  VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVTEIARIMRPR 120

Query: 366 SCAKDLANGCKEILGTAVSVGCKVDGKDPRDVISAIDDGAIEIPD 500
           S AK+L+   +EILGT VSVGC VDGKDP+D+   I DG +EIP+
Sbjct: 121 SIAKELSGTVREILGTCVSVGCTVDGKDPKDIQQEIQDGEVEIPE 165

>sp|O50003|RL12_PRUAR 60S RIBOSOMAL PROTEIN L12 gi|2677830|gb|AAB97143.1| ribosomal
           protein L12 [Prunus armeniaca]
          Length = 166

 Score =  255 bits (652), Expect = 3e-67
 Identities = 127/164 (77%), Positives = 143/164 (86%)
 Frame = +3

Query: 6   MPPKFDPSDVVEVCVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETLKDWKGLRIT 185
           MPPKFDPS VV+V VRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKET  DWKGLR+T
Sbjct: 1   MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETANDWKGLRVT 60

Query: 186 VKLTVQNRQAKISVIPSAAALVIKALKEPARDRKKEKNIKHTGSVTMSDIIEIARVMRPR 365
           VKLTVQNRQAK+SV+PSAAALVIKALKEP RDRKK KNIKH+G +++ D+IEIA++M+ R
Sbjct: 61  VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHSGHISLDDVIEIAKIMKHR 120

Query: 366 SCAKDLANGCKEILGTAVSVGCKVDGKDPRDVISAIDDGAIEIP 497
           S AK+LA   KEIL T VSVGC VDGKDP+D+   I DG +EIP
Sbjct: 121 SMAKELAGTVKEILRTCVSVGCTVDGKDPKDLQQEIADGDVEIP 164

>ref|NP_190911.1| 60S ribosomal protein L12 (RPL12B) [Arabidopsis thaliana]
           gi|11276750|pir||T45883 60S RIBOSOMAL PROTEIN L12-like -
           Arabidopsis thaliana gi|6729494|emb|CAB67650.1| 60S
           RIBOSOMAL PROTEIN L12-like [Arabidopsis thaliana]
           gi|22655306|gb|AAM98243.1| 60S ribosomal protein
           L12-like protein [Arabidopsis thaliana]
           gi|27311969|gb|AAO00950.1| 60S ribosomal protein
           L12-like protein [Arabidopsis thaliana]
          Length = 166

 Score =  255 bits (652), Expect = 3e-67
 Identities = 124/165 (75%), Positives = 144/165 (87%)
 Frame = +3

Query: 6   MPPKFDPSDVVEVCVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETLKDWKGLRIT 185
           MPPK DPS +V+V VRVTGGEVGAASSLAPKIGPLGL+PKKIGEDIAKET K+WKGLR+T
Sbjct: 1   MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT 60

Query: 186 VKLTVQNRQAKISVIPSAAALVIKALKEPARDRKKEKNIKHTGSVTMSDIIEIARVMRPR 365
           VKLTVQNRQAK++V+PSAAALVIKALKEP RDRKK KNIKH G+++  D+ EIAR+MRPR
Sbjct: 61  VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVTEIARIMRPR 120

Query: 366 SCAKDLANGCKEILGTAVSVGCKVDGKDPRDVISAIDDGAIEIPD 500
           S AK+L+   +EILGT VSVGC VDGKDP+D+   I +G IEIP+
Sbjct: 121 SIAKELSGTVREILGTCVSVGCTVDGKDPKDLQQEIQEGEIEIPE 165



EST assemble image


clone accession position
1 CL45b11_r AV397796 1 629
2 MXL057f06_r BP096370 7 517
3 CL34f12_r AV394942 11 639
4 CL21b03_r AV394338 12 624
5 CM061g04_r AV390609 81 692
6 MXL099a03_r BP098778 82 466
7 MXL043c01_r BP095525 82 460
8 LC082h01_r AV624794 83 629
9 LC063a05_r AV623386 84 610
10 HCL064g03_r AV643154 84 596
11 CL50c09_r AV395755 84 566
12 MXL004h07_r BP093199 84 418
13 CM009d01_r AV397657 85 663
14 HC082h12_r AV638183 86 528
15 LC096g10_r AV625714 86 537
16 MXL054b04_r BP096179 86 200
17 CM012c09_r AV387140 88 535
18 HC035h02_r AV634634 88 597
19 HC076d03_r AV637696 88 544
20 CL15a10_r AV393941 89 572
21 CL13h06_r AV393913 89 610
22 CL33b09_r AV394948 89 639
23 MX048c09_r BP087971 92 317
24 CM056d01_r AV390284 93 601
25 HCL036d07_r AV641565 95 575
26 CL33g02_r AV394993 95 628
27 CS001h12_r AV397974 95 677
28 CL58c04_r AV396196 95 484
29 MXL054a05_r BP096171 96 535
30 CL67b08_r AV396692 96 677
31 CL37e05_r AV395271 98 604
32 CL25d05_r AV394519 100 640
33 CL31f01_r AV395041 100 663
34 CL75h08_r AV397085 100 605
35 CL20b08_r AV394331 100 666
36 CL33b10_r AV394952 100 602
37 CM085g12_r AV392411 100 575
38 HCL056h04_r AV642730 100 629
39 CM099d07_r AV393118 101 629
40 CL21h05_r AV394384 102 648
41 CL02b01_r AV397593 102 663
42 CL55h08_r AV396030 102 637
43 CL66a01_r AV396735 102 649
44 CL01h07_r AV393330 106 640
45 CL20f08_r AV394334 109 629
46 CS001d09_r AV398017 109 358
47 CM031f03_r AV388301 109 411
48 CL25f04_r AV394526 109 654
49 CL45c03_r AV397768 109 622
50 CL59c03_r AV397903 109 692
51 CL44e06_r AV395591 110 566
52 CL53g12_r AV395988 111 679
53 CL43c01_r AV395533 120 651
54 HC094c12_r AV639047 121 561
55 CL27e07_r AV394731 122 652
56 MXL096b02_r BP098599 129 536
57 CL64b06_r AV396656 131 689
58 CL11c02_r AV393754 142 664
59 HC100f07_r AV639535 153 609
60 CL68d04_r AV396943 153 667
61 CL55d02_r AV396050 159 598
62 CS001a08_r AV397941 161 708
63 CL75a03_r AV397091 166 717
64 CL52a10_r AV395872 167 514
65 CM026h12_r AV387531 178 679
66 CL17c09_r AV394111 180 693
67 CL25b04_r AV394521 185 701
68 CL60d07_r AV396352 197 791
69 CL18d05_r AV394056 197 693
70 CL03d01_r AV393412 203 692
71 CL40h05_r AV395347 203 692
72 CL67b06_r AV396677 220 693




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research