KCC000033A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000033A_C01 KCC000033A_c01
gtaGACACAACTTCTAGCATAGGCCAAAAACTGACTTAGCACGCTGCCGGCAGCCCCGGC
TTTCCGAGAATCTCGGCCAGTCGCTCGACAAAGTTCTCCTACGCGCTCGCTGAGCACCCA
GATCACCTTGCAAACACGGTCTTGCACATGGCTTGACAATTCTGCATCGTCTGGTTCTGA
AGCAACCTGTGGAAAGCCCAGGGGTCTCGGTTATATTTCGGGGAGCGCCGCTCAGGAAGC
GCTGTGCTTGGCGCGCCGAATCAAGAATGCCTTTCCAGTCCAACTTCCAGCTAATTAAAG
CCTCCTACAAGGAGTTCCTGCGGAAGGTTGCCGCGGCGCACCGTGGCGATGGCGCGGGCG
AGGCGGGCCCCGCCCACTACTATGTGGAGCGCGTGTATGCGGACGCCTCGCTCGACCAGT
CCCTCGCCAGGCTGCAGACCCAGCTGCTGGCATCCGTGGACGTCGCCGAGCTGCGGGCCG
CTTACCAGGCACGAAAGCTGCGCGCCAAG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000033A_C01 KCC000033A_c01
         (509 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|ZP_00051079.1| COG1132: ABC-type multidrug transport system,...    41  0.010
ref|ZP_00057851.1| COG0596: Predicted hydrolases or acyltransfer...    40  0.013
ref|ZP_00138924.1| COG1629: Outer membrane receptor proteins, mo...    39  0.049
ref|ZP_00059221.1| COG0765: ABC-type amino acid transport system...    38  0.065
ref|NP_823720.1| hypothetical protein [Streptomyces avermitilis ...    38  0.065

>ref|ZP_00051079.1| COG1132: ABC-type multidrug transport system, ATPase and permease
           components [Magnetospirillum magnetotacticum]
          Length = 423

 Score = 40.8 bits (94), Expect = 0.010
 Identities = 18/34 (52%), Positives = 20/34 (57%)
 Frame = -3

Query: 426 RGTGRARRPHTRAPHSSGRGPPRPRHRHGAPRQP 325
           RG+ RAR P     H SGR PP  RHR G+P  P
Sbjct: 8   RGSPRARSPAPARRHRSGRSPPTARHREGSPAPP 41

>ref|ZP_00057851.1| COG0596: Predicted hydrolases or acyltransferases (alpha/beta
           hydrolase superfamily) [Thermobifida fusca]
          Length = 529

 Score = 40.4 bits (93), Expect = 0.013
 Identities = 31/67 (46%), Positives = 35/67 (51%), Gaps = 3/67 (4%)
 Frame = -3

Query: 492 VPGKRPAARRRPRMPAAGSAAWRGTGRARRPHTRAPHSSGRGPPRPRHRHGAPRQP---S 322
           +PG  P  R R R+ +AGSA  +  GR RR H R  H   R    PRHRH A RQP    
Sbjct: 11  LPGAEPPQRGRSRLRSAGSAG-QHPGRRRRHHPRRGHRRLR-HRFPRHRH-ADRQPYLRR 67

Query: 321 AGTPCRR 301
            GT  RR
Sbjct: 68  RGTIARR 74

>ref|ZP_00138924.1| COG1629: Outer membrane receptor proteins, mostly Fe transport
           [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 1175

 Score = 38.5 bits (88), Expect = 0.049
 Identities = 30/76 (39%), Positives = 32/76 (41%), Gaps = 13/76 (17%)
 Frame = +2

Query: 314 VPAEGCRGAPWRWRGRG-GPRPLLCGARVCG--------RLARPVPRQAADPAAG----I 454
           VP EGCR     WR R  GPR    G R CG        R A  VPRQAA    G    +
Sbjct: 167 VPGEGCRTCAAGWRQRAPGPRRPAPGTRPCGAGAGRQLARWATGVPRQAAGRTGGGTVAL 226

Query: 455 RGRRRAAGRLPGTKAA 502
             R    GR P  + A
Sbjct: 227 SCRADPPGRSPACRQA 242

>ref|ZP_00059221.1| COG0765: ABC-type amino acid transport system, permease component
           [Thermobifida fusca]
          Length = 327

 Score = 38.1 bits (87), Expect = 0.065
 Identities = 27/60 (45%), Positives = 31/60 (51%), Gaps = 5/60 (8%)
 Frame = -3

Query: 468 RRRP---RMPAAGSAAWRGTGRARRPHTRAPH--SSGRGPPRPRHRHGAPRQPSAGTPCR 304
           R+RP   R  AAG     G G  RRPH   PH  ++ RG   P    G PRQP+AGT  R
Sbjct: 40  RQRPDPGRPRAAGLHRGDGRGLHRRPHRLLPHRPAADRGNAAP----GTPRQPAAGTARR 95

>ref|NP_823720.1| hypothetical protein [Streptomyces avermitilis MA-4680]
           gi|29606192|dbj|BAC70255.1| hypothetical protein
           [Streptomyces avermitilis MA-4680]
          Length = 810

 Score = 38.1 bits (87), Expect = 0.065
 Identities = 26/69 (37%), Positives = 30/69 (42%), Gaps = 11/69 (15%)
 Frame = -3

Query: 489 PGKRPAARRRPRMPAAGSAAWRGTGR-----------ARRPHTRAPHSSGRGPPRPRHRH 343
           P +RP    RPR P + S + R + R            RRPH R P    R  PR R   
Sbjct: 81  PSRRPRRASRPRRPGSRSRSPRSSRRHRSRHPRPGTSLRRPHPRIPCPRRRPTPRARVT- 139

Query: 342 GAPRQPSAG 316
           GAP  P AG
Sbjct: 140 GAPAAPQAG 148

 Score = 33.1 bits (74), Expect = 2.1
 Identities = 21/58 (36%), Positives = 26/58 (44%), Gaps = 1/58 (1%)
 Frame = -3

Query: 489 PGKRPAARRRPRMPAAGSAAWRGTGRARRP-HTRAPHSSGRGPPRPRHRHGAPRQPSA 319
           P  RP   RRP  P   S A R   R + P  ++A  S  R P R   R   PR+P +
Sbjct: 39  PISRPRPHRRPSGPRLRSRASRRAPRPQPPLPSKASRSRSRSPSRRPRRASRPRRPGS 96



EST assemble image


clone accession position
1 LCL082e02_r AV630671 1 274
2 LCL048f07_r AV628898 4 345
3 HCL047c08_r AV642197 4 290
4 LCL084a09_r AV630767 8 499
5 CL01h01_r AV393313 14 509
6 LCL071h06_r AV630043 25 222




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research