KCC000032A_c03
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000032A_C03 KCC000032A_c03
CCGACACAATGTCGAGCCGTTGTGCCTGAGCTCCTCGCCAAGAAGCGCAAGCGGGACGAC
GAGGGCCGCTGCCAAGCGGGCGGCGGACGCTCTGACGTCGCGCAAGAAGGCCCGTGCCAC
TCGCAAGGACATCTTCAAGCGCGCGGAGAAGTATGTGGCCGAGTACCGCACTCAGGAGAA
GGACATTGTCCGCCTGAAGCGCGAGGCCCGGTCCAAGGGTGGCTTCTACGTGCCCCCTGA
GGCCAAGGTCATCTTCGTGGTGCGCATCCGCGGTCTGAACAAGATTGCCCCCAAGACCAA
GAAGATCCTGCAGCTGCTGCGGCCTGAAGCAGCTGAACATGGGCGTGTTCCTGAAGGTGA
GCAAGCCCGCTGCTCAACATGCTCCAGCGCGTGGAGCCCTACGTGGCTTTCGGCTACCCC
AACCTCAAGTCGGTGCGGGAGCTGATCTACAAGCGCGGCTACGCCAAGATCAAGAACAAC
CGCATCCCCCTGACCGGACAACCGGATCATTGAGGAGAACCTGGGCAAGCACGGGCTGAT
CTGCATGGAGGACCTGGTGCACGAGATCTACACCTGCGGCCCCAAGTTCAAGGAGGTGAG
CACCTTCCTGTGGCCCTTCAAGCTGTCGTCGCCCAACGGCGGCATGGACAAGAAGCGCCT
GCACTACGTGGAGGGCGGCCAGGCCGGCAACCGCGAGGACAAGATCAACGCCTTCATCCG
CAAGATGAACTAAGCGGATGGTCTTGGACAGGCGGCGGCGGCATGGACGCTGTGCAGGAA
GGGCTCGGCTGGCGGCGGGCGTTTGCAGCAGCGGCGGCTGAGCGCGGCGTGGGTCTGGGG
CCTCTGACCGCGTCGCGCGCCGTGGAGACGCGTTTTAGCTGCCCGTGTGGGTGCGAAACC
GCTGCGGGGTGGGGTGTGCGCTCCTGTGGAGCAGCCCCCGCCCCCGCCGCCAGTTGGAAG
GGCGCGTGGGCCCTAGTGCTGGGGCCGGCTTGCCGGTCGGGAGAGTGTAATTCAAAACCC
GTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000032A_C03 KCC000032A_c03
         (1023 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_178234.1| 60S ribosomal protein L7 (RPL7B) [Arabidopsis t...   195  5e-50
ref|NP_850410.1| 60S ribosomal protein L7 (RPL7C) [Arabidopsis t...   197  2e-49
ref|NP_850411.1| 60S ribosomal protein L7 (RPL7C) [Arabidopsis t...   197  2e-49
emb|CAE02125.1| OSJNBa0035M09.5 [Oryza sativa (japonica cultivar...   196  4e-49
ref|NP_187967.1| 60S ribosomal protein L7 (RPL7D) [Arabidopsis t...   192  6e-49

>ref|NP_178234.1| 60S ribosomal protein L7 (RPL7B) [Arabidopsis thaliana]
           gi|25295066|pir||D84422 60S ribosomal protein L7
           [imported] - Arabidopsis thaliana
           gi|4262232|gb|AAD14525.1| putative ribosomal protein L7
           [Arabidopsis thaliana]
           gi|13877567|gb|AAK43861.1|AF370484_1 60S ribosomal
           protein L7 [Arabidopsis thaliana]
           gi|15028383|gb|AAK76668.1| putative ribosomal protein L7
           [Arabidopsis thaliana] gi|19310657|gb|AAL85059.1|
           putative ribosomal protein L7 [Arabidopsis thaliana]
           gi|20148739|gb|AAM10260.1| 60S ribosomal protein L7
           [Arabidopsis thaliana] gi|21537351|gb|AAM61692.1|
           putative ribosomal protein L7 [Arabidopsis thaliana]
          Length = 242

 Score =  195 bits (496), Expect(2) = 5e-50
 Identities = 105/221 (47%), Positives = 136/221 (61%)
 Frame = +2

Query: 68  AAKRAADALTSRKKARATRKDIFKRAEKYVAEYRTQEKDIVRLKREARSKGGFYVPPEAK 247
           A ++  +   ++KK    RK IFKRAE+Y  EY  +EK+++ LKREA+ KGGFYV PEAK
Sbjct: 23  ALEKKQNVEAAKKKNAENRKLIFKRAEQYSKEYAEKEKELISLKREAKLKGGFYVDPEAK 82

Query: 248 VIFVVRIRGLNKIAPKTKKILQLLRPEAAEHGRVPEGEQARCSTCSSAWSPTWLSATPTS 427
           ++F++RIRG+N I PKTKKILQLLR     +G   +  +A  +       P      P  
Sbjct: 83  LLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATMNMLRRV-EPYVTYGFPNL 141

Query: 428 SRCGS*STSAATPRSRTTASP*PDNRIIEENLGKHGLICMEDLVHEIYTCGPKFKEVSTF 607
                        +         DN I+E+ LGKHG+IC EDL+HEI T GP FKE + F
Sbjct: 142 KSVKELIYKRGYGKLNHQRIALTDNSIVEQALGKHGIICTEDLIHEILTVGPHFKEANNF 201

Query: 608 LWPFKLSSPNGGMDKKRLHYVEGGQAGNREDKINAFIRKMN 730
           LWPF+L +P GG+ KKR HYVEGG AGNRE+ IN  IR+MN
Sbjct: 202 LWPFQLKAPLGGLKKKRNHYVEGGDAGNRENFINELIRRMN 242

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 29/41 (70%), Positives = 36/41 (87%)
 Frame = +1

Query: 373 LNMLQRVEPYVAFGYPNLKSVRELIYKRGYAKIKNNRIPLT 495
           +NML+RVEPYV +G+PNLKSV+ELIYKRGY K+ + RI LT
Sbjct: 124 MNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKLNHQRIALT 164

 Score = 25.8 bits (55), Expect(2) = 5e-50
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = +1

Query: 7  QCRAVVPELLAKKRKRDDE 63
          + + VVPE + KKRKR++E
Sbjct: 3  ESKVVVPESVLKKRKREEE 21

>ref|NP_850410.1| 60S ribosomal protein L7 (RPL7C) [Arabidopsis thaliana]
           gi|15450713|gb|AAK96628.1| At2g44120/F6E13.25
           [Arabidopsis thaliana]
           gi|17386142|gb|AAL38617.1|AF446884_1 At2g44120/F6E13.25
           [Arabidopsis thaliana] gi|17473920|gb|AAL38372.1| 60S
           ribosomal protein L7 [Arabidopsis thaliana]
           gi|20148291|gb|AAM10036.1| 60S ribosomal protein L7
           [Arabidopsis thaliana] gi|21593176|gb|AAM65125.1| 60S
           ribosomal protein L7 [Arabidopsis thaliana]
          Length = 242

 Score =  197 bits (501), Expect = 2e-49
 Identities = 103/221 (46%), Positives = 139/221 (62%)
 Frame = +2

Query: 68  AAKRAADALTSRKKARATRKDIFKRAEKYVAEYRTQEKDIVRLKREARSKGGFYVPPEAK 247
           A  +  +A+ ++KK+   RK IFKRAE+Y  EY  ++ +++RLKREA+ KGGFYV PEAK
Sbjct: 23  ALAKKDEAVAAKKKSVEARKLIFKRAEQYAKEYAEKDNELIRLKREAKLKGGFYVDPEAK 82

Query: 248 VIFVVRIRGLNKIAPKTKKILQLLRPEAAEHGRVPEGEQARCSTCSSAWSPTWLSATPTS 427
           ++F++RIRG+N I PKTKKILQLLR     +G   +  +A  +       P      P  
Sbjct: 83  LLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATVNMLRRV-EPYVTYGYPNL 141

Query: 428 SRCGS*STSAATPRSRTTASP*PDNRIIEENLGKHGLICMEDLVHEIYTCGPKFKEVSTF 607
                        +         DN I+++ LGKHG+IC+EDL+HEI T GP FKE + F
Sbjct: 142 KSVKELIYKRGYGKLNHQRIALTDNSIVDQALGKHGIICVEDLIHEIMTVGPHFKEANNF 201

Query: 608 LWPFKLSSPNGGMDKKRLHYVEGGQAGNREDKINAFIRKMN 730
           LWPF+L +P GG+ KKR HYVEGG AGNRE+ IN  +R+MN
Sbjct: 202 LWPFQLKAPLGGLKKKRNHYVEGGDAGNRENFINELVRRMN 242

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 30/41 (73%), Positives = 36/41 (87%)
 Frame = +1

Query: 373 LNMLQRVEPYVAFGYPNLKSVRELIYKRGYAKIKNNRIPLT 495
           +NML+RVEPYV +GYPNLKSV+ELIYKRGY K+ + RI LT
Sbjct: 124 VNMLRRVEPYVTYGYPNLKSVKELIYKRGYGKLNHQRIALT 164

>ref|NP_850411.1| 60S ribosomal protein L7 (RPL7C) [Arabidopsis thaliana]
           gi|6174958|sp|Q42208|RL7_ARATH 60S ribosomal protein L7
           gi|7440720|pir||T00692 60S ribosomal protein L7
           [imported] - Arabidopsis thaliana
           gi|3212879|gb|AAC23430.1| 60S ribosomal protein L7
           [Arabidopsis thaliana]
          Length = 247

 Score =  197 bits (501), Expect = 2e-49
 Identities = 103/221 (46%), Positives = 139/221 (62%)
 Frame = +2

Query: 68  AAKRAADALTSRKKARATRKDIFKRAEKYVAEYRTQEKDIVRLKREARSKGGFYVPPEAK 247
           A  +  +A+ ++KK+   RK IFKRAE+Y  EY  ++ +++RLKREA+ KGGFYV PEAK
Sbjct: 28  ALAKKDEAVAAKKKSVEARKLIFKRAEQYAKEYAEKDNELIRLKREAKLKGGFYVDPEAK 87

Query: 248 VIFVVRIRGLNKIAPKTKKILQLLRPEAAEHGRVPEGEQARCSTCSSAWSPTWLSATPTS 427
           ++F++RIRG+N I PKTKKILQLLR     +G   +  +A  +       P      P  
Sbjct: 88  LLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATVNMLRRV-EPYVTYGYPNL 146

Query: 428 SRCGS*STSAATPRSRTTASP*PDNRIIEENLGKHGLICMEDLVHEIYTCGPKFKEVSTF 607
                        +         DN I+++ LGKHG+IC+EDL+HEI T GP FKE + F
Sbjct: 147 KSVKELIYKRGYGKLNHQRIALTDNSIVDQALGKHGIICVEDLIHEIMTVGPHFKEANNF 206

Query: 608 LWPFKLSSPNGGMDKKRLHYVEGGQAGNREDKINAFIRKMN 730
           LWPF+L +P GG+ KKR HYVEGG AGNRE+ IN  +R+MN
Sbjct: 207 LWPFQLKAPLGGLKKKRNHYVEGGDAGNRENFINELVRRMN 247

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 30/41 (73%), Positives = 36/41 (87%)
 Frame = +1

Query: 373 LNMLQRVEPYVAFGYPNLKSVRELIYKRGYAKIKNNRIPLT 495
           +NML+RVEPYV +GYPNLKSV+ELIYKRGY K+ + RI LT
Sbjct: 129 VNMLRRVEPYVTYGYPNLKSVKELIYKRGYGKLNHQRIALT 169

>emb|CAE02125.1| OSJNBa0035M09.5 [Oryza sativa (japonica cultivar-group)]
           gi|32489764|emb|CAE03888.1| OSJNBb0015N08.16 [Oryza
           sativa (japonica cultivar-group)]
          Length = 250

 Score =  196 bits (497), Expect(2) = 4e-49
 Identities = 109/227 (48%), Positives = 139/227 (61%), Gaps = 6/227 (2%)
 Frame = +2

Query: 68  AAKRAADALTSRKKARATRKDIFKRAEKYVAEYRTQEKDIVRLKREARSKGGFYVPPEAK 247
           AA     A+  +KK+  +RK IF RA++Y  EY  QEK++V+LKREAR KGGFYV PE K
Sbjct: 25  AAASKEKAVAEKKKSIESRKLIFSRAKQYAEEYEAQEKELVQLKREARMKGGFYVSPEEK 84

Query: 248 VIFVVRIRGLNKIAPKTKKILQLLRPEAAEHGRVPEGEQARCSTCSSAWSPTWLSATPTS 427
           ++FVVRIRG+N + PKT+KILQLLR     +G   +  +A  +       P      P  
Sbjct: 85  LLFVVRIRGINAMHPKTRKILQLLRLRQIFNGVFLKVNKATINMLRRV-EPYVAYGYPNL 143

Query: 428 SRCGS*STSAATPRSRTTASP*PDNRIIEEN------LGKHGLICMEDLVHEIYTCGPKF 589
                        +      P  +N++IEE+      LGKH +IC+EDLVHEI T GP F
Sbjct: 144 KSVRELIYKRGYGKLNKQRIPLTNNKVIEESWCLYQGLGKHDIICIEDLVHEIMTVGPHF 203

Query: 590 KEVSTFLWPFKLSSPNGGMDKKRLHYVEGGQAGNREDKINAFIRKMN 730
           KE + FLWPFKL +P GG+ KKR HYVEGG AGNRE+ IN  IR+MN
Sbjct: 204 KEANNFLWPFKLKAPLGGLKKKRNHYVEGGDAGNRENYINELIRRMN 250

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 33/41 (80%), Positives = 37/41 (89%)
 Frame = +1

Query: 373 LNMLQRVEPYVAFGYPNLKSVRELIYKRGYAKIKNNRIPLT 495
           +NML+RVEPYVA+GYPNLKSVRELIYKRGY K+   RIPLT
Sbjct: 126 INMLRRVEPYVAYGYPNLKSVRELIYKRGYGKLNKQRIPLT 166

 Score = 22.3 bits (46), Expect(2) = 4e-49
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = +1

Query: 13 RAVVPELLAKKRKRDD 60
          + VVPE + +KRKR++
Sbjct: 7  KVVVPESVLRKRKREE 22

>ref|NP_187967.1| 60S ribosomal protein L7 (RPL7D) [Arabidopsis thaliana]
           gi|11994560|dbj|BAB02600.1| 60S ribosomal protein L7
           [Arabidopsis thaliana] gi|14532552|gb|AAK64004.1|
           AT3g13580/K20M4_2 [Arabidopsis thaliana]
           gi|15810196|gb|AAL06999.1| AT3g13580/K20M4_2
           [Arabidopsis thaliana] gi|18655395|gb|AAL76153.1|
           AT3g13580/K20M4_2 [Arabidopsis thaliana]
          Length = 244

 Score =  192 bits (487), Expect(2) = 6e-49
 Identities = 99/211 (46%), Positives = 135/211 (63%)
 Frame = +2

Query: 98  SRKKARATRKDIFKRAEKYVAEYRTQEKDIVRLKREARSKGGFYVPPEAKVIFVVRIRGL 277
           ++K+    RK IF RA++Y  EY+ +E+++++LKREA+ KGGFYV PEAK++F++RIRG+
Sbjct: 35  AKKQNAEKRKLIFNRAKQYSKEYQEKERELIQLKREAKLKGGFYVDPEAKLLFIIRIRGI 94

Query: 278 NKIAPKTKKILQLLRPEAAEHGRVPEGEQARCSTCSSAWSPTWLSATPTSSRCGS*STSA 457
           N I PKTKKILQLLR     +G   +  +A  +       P      P            
Sbjct: 95  NAIDPKTKKILQLLRLRQIFNGVFLKVNKATINMLRRV-EPYVTYGYPNLKSVKELIYKR 153

Query: 458 ATPRSRTTASP*PDNRIIEENLGKHGLICMEDLVHEIYTCGPKFKEVSTFLWPFKLSSPN 637
              +     +   DN I+++ LGKHG+IC+EDL+HEI T GP FKE + FLWPF+L +P 
Sbjct: 154 GFGKLNHQRTALTDNSIVDQGLGKHGIICVEDLIHEIMTVGPHFKEANNFLWPFQLKAPL 213

Query: 638 GGMDKKRLHYVEGGQAGNREDKINAFIRKMN 730
           GGM KKR HYVEGG AGNRE+ IN  +R+MN
Sbjct: 214 GGMKKKRNHYVEGGDAGNRENFINELVRRMN 244

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 28/41 (68%), Positives = 35/41 (85%)
 Frame = +1

Query: 373 LNMLQRVEPYVAFGYPNLKSVRELIYKRGYAKIKNNRIPLT 495
           +NML+RVEPYV +GYPNLKSV+ELIYKRG+ K+ + R  LT
Sbjct: 126 INMLRRVEPYVTYGYPNLKSVKELIYKRGFGKLNHQRTALT 166

 Score = 25.8 bits (55), Expect(2) = 6e-49
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = +1

Query: 7  QCRAVVPELLAKKRKRDDE 63
          + + VVPE + KKRKR++E
Sbjct: 5  ESKTVVPESVLKKRKREEE 23



EST assemble image


clone accession position
1 HC048b08_r AV635583 1 638
2 HC056c10_r AV636191 10 617
3 HC039e08_r AV634909 13 712
4 CL60c04_r AV396394 15 729
5 HC035c02_r AV634582 15 718
6 CL52c06_r AV395855 25 499
7 MX102e12_r BP088911 30 574
8 HC043h03_r AV635250 31 678
9 HC059f09_r AV636451 32 650
10 CM069h12_r AV391241 102 688
11 LC066h11_r AV623662 102 653
12 CM026b08_r AV387512 102 754
13 CM055c03_r AV390231 105 776
14 CM064h02_r AV390966 105 662
15 CM091g04_r AV397542 107 626
16 HC052c07_r AV635888 107 617
17 LC001c09_r AV618915 107 714
18 LC067g06_r AV623723 107 713
19 LC035c02_r AV621379 108 714
20 CM053h09_r AV389900 108 463
21 CM067h08_r AV390912 108 673
22 CM098f06_r AV392893 108 602
23 LCL075d04_r AV630206 108 623
24 HC080b07_r AV637976 109 600
25 CL04c03_r AV393362 109 738
26 CM082b08_r AV392112 110 757
27 CM088g05_r AV393047 110 734
28 CM049a06_r AV389622 110 479
29 CM008c10_r AV386736 110 735
30 CM048a01_r AV389107 110 559
31 CM100a07_r AV392851 110 714
32 CM080a02_r AV392021 110 742
33 CM004b07_r AV386644 110 726
34 CM009h11_r AV397695 110 756
35 CM063c03_r AV390041 110 803
36 CM018d04_r AV387241 110 711
37 CM018e08_r AV387264 110 720
38 LC002g06_r AV619026 110 738
39 CM064h06_r AV390971 110 767
40 CM046c12_r AV387986 110 462
41 CM020a10_r AV397478 110 776
42 CM021g04_r AV387975 110 756
43 CM029b10_r AV389339 111 800
44 MX048g02_r BP087987 111 258
45 HC097b12_r AV639271 111 619
46 HC060a07_r AV636477 111 723
47 LC100b07_r AV625946 111 554
48 MX223g10_r BP090429 111 623
49 LCL047d05_r AV628808 111 714
50 HC043g11_r AV635246 111 604
51 LCL078g06_r AV630432 111 672
52 LCL099g10_r AV631783 111 673
53 MX065a07_r BP088616 111 530
54 LC057e05_r AV622991 111 686
55 LC024a03_r AV620583 111 712
56 MX051a10_r BP088079 111 613
57 MX052c01_r BP088123 111 645
58 MX061b11_r BP088469 111 524
59 LC006e10_r AV619317 111 732
60 LCL077e02_r AV630337 111 624
61 LC005g03_r AV619254 113 628
62 HC052h04_r AV635931 113 633
63 MX002f06_r BP086141 113 560
64 CM081f09_r AV391923 113 576
65 HCL080f12_r AV644038 113 688
66 MXL083b01_r BP097896 113 567
67 CM093a03_r AV392970 113 714
68 HC083f04_r AV638233 113 686
69 HC055d02_r AV636115 113 686
70 HC045d11_r AV635363 113 638
71 HC092c07_r AV638899 113 606
72 LC069c11_r AV623835 113 730
73 MX031b03_r BP087297 113 623
74 CM053a02_r AV389914 113 735
75 HC066d09_r AV636942 113 617
76 CM052h03_r AV390548 114 737
77 CM024d01_r AV388242 114 769
78 CM024f01_r AV388286 114 747
79 CM022h07_r AV387900 114 761
80 CM019c03_r AV387296 114 716
81 CM040b11_r AV389184 114 734
82 CM021h01_r AV387947 114 774
83 CM100a01_r AV392833 114 575
84 CM087e11_r AV392462 114 717
85 MX236f09_r BP091303 114 428
86 LC074h09_r AV624239 114 650
87 CM045e10_r AV389703 114 621
88 LC081b01_r AV624674 114 618
89 LC063h07_r AV623446 114 704
90 HC004d08_r AV632138 115 671
91 CM043d05_r AV389465 117 464
92 CL74b02_r AV396453 117 599
93 LC054g10_r AV622803 117 678
94 MX101a04_r BP088783 117 712
95 MXL045g01_r BP095680 117 627
96 MX224h05_r BP090501 117 477
97 CM043a05_r AV389462 117 467
98 MXL055e10_r BP096258 117 653
99 CM002b08_r AV397822 117 734
100 CM051a06_r AV389870 117 712
101 CM011g09_r AV386913 117 727
102 HC051e04_r AV635829 117 628
103 CM046a06_r AV388004 117 746
104 CM024e04_r AV388230 117 778
105 CM020c04_r AV397480 117 769
106 CM045c02_r AV389671 117 739
107 MXL063f08_r BP096717 117 549
108 CM010c08_r AV386971 117 622
109 HC046c02_r AV635427 117 711
110 CM049a12_r AV389610 117 483
111 LC039b09_r AV621655 117 715
112 HCL041a05_r AV641830 117 722
113 LCL096a09_r AV631549 117 468
114 CM084f02_r AV392645 118 573
115 CM079d09_r AV391980 118 728
116 CM051a10_r AV389841 118 733
117 CM042c01_r AV389266 118 461
118 CM066e01_r AV390863 118 754
119 CM089g07_r AV392262 119 768
120 CM094a05_r AV393254 119 711
121 LC074d05_r AV624204 119 646
122 MXL028e08_r BP094739 119 640
123 CL76h11_r AV397130 119 653
124 LC006d08_r AV619307 119 746
125 LC042c03_r AV621888 119 739
126 LC069f03_r AV623856 119 714
127 CM092g10_r AV392675 119 718
128 LC006c02_r AV619292 119 710
129 HC076h03_r AV637737 120 549
130 CM051b11_r AV389878 120 747
131 LC078d07_r AV624486 120 686
132 CM034g09_r AV388680 120 712
133 CL64f05_r AV396616 120 732
134 CM100d04_r AV392807 120 704
135 HCL008d09_r AV639992 120 719
136 CM027c06_r AV387651 120 789
137 CM013h02_r AV387058 120 709
138 CM031d11_r AV388332 120 563
139 MXL042b03_r BP095459 120 556
140 CM060e08_r AV390767 120 713
141 CM024a05_r AV388243 120 771
142 CM040f12_r AV389221 120 749
143 CM076a02_r AV391724 120 801
144 CM049g03_r AV389603 120 283
145 CM065c11_r AV391104 120 514
146 HC077e12_r AV637795 120 646
147 HCL073d04_r AV643649 120 647
148 MX103e11_r BP088994 120 594
149 HC071f07_r AV637323 120 653
150 CM048d08_r AV389145 120 472
151 HC047f06_r AV635540 120 662
152 CM081e08_r AV391868 120 748
153 CM003a12_r AV386607 120 739
154 HC041d10_r AV635064 120 669
155 CM019a07_r AV387358 120 775
156 HC023g09_r AV633671 120 643
157 CM041e07_r AV389430 120 755
158 CM040e09_r AV389194 120 747
159 CL01g10_r AV393302 120 677
160 MX006d06_r BP086315 120 583
161 CM056d03_r AV390265 120 797
162 CM040b03_r AV389159 120 753
163 HC020b04_r AV633377 121 626
164 CM045e08_r AV389717 121 545
165 CM057c04_r AV390418 121 696
166 HC054a09_r AV636016 121 584
167 CM028b07_r AV387689 121 773
168 HC031d07_r AV634281 122 718
169 CM009a11_r AV397653 123 762
170 CL59a03_r AV397901 123 743
171 LC073e05_r AV624143 123 689
172 HC005d01_r AV632211 123 714
173 CL56f01_r AV396075 123 467
174 CM030c04_r AV397409 123 805
175 CM024c07_r AV388235 124 793
176 CM019b12_r AV387340 125 776
177 HC099d05_r AV639438 125 618
178 MX043a08_r BP087758 126 627
179 HCL100e03_r AV645273 126 680
180 CM073c07_r AV391401 127 783
181 CL62b07_r AV396413 128 743
182 LC012d01_r AV619732 128 714
183 CL29g05_r AV394666 129 685
184 LCL047b03_r AV628787 132 705
185 MXL057c06_r BP096352 132 584
186 MX036b04_r BP087514 134 556
187 CM074e03_r AV391508 164 630
188 CM020b10_r AV397500 171 816
189 MX214h01_r BP089847 202 659
190 CL16b01_r AV393991 217 802
191 HC097e10_r AV639298 236 723
192 CM079a08_r AV391993 240 742
193 LC015a02_r AV619917 264 829
194 CM091d12_r AV397559 269 652
195 CM091a05_r AV397516 286 613
196 CM085a01_r AV392380 287 672
197 CM096h01_r AV392762 288 714
198 MXL073a05_r BP097283 290 792
199 MX022d11_r BP086995 414 879
200 CL19h09_r AV394201 517 1114
201 MXL026d05_r BP094649 523 792
202 LC034g01_r AV621345 556 1096
203 CM080a04_r AV392064 641 1245
204 CM028b11_r AV387712 649 1242
205 CM017g06_r AV388186 665 1223
206 LC027f08_r AV620849 671 1303
207 LC026h02_r AV620787 681 1186
208 CL61h04_r AV396345 686 1224
209 HC014a06_r AV632892 695 1197
210 LC081d10_r AV624703 716 1235
211 CL66d08_r AV396755 730 1197
212 LC078f05_r AV624505 735 1244
213 CM081b03_r AV391871 738 1044
214 HCL091b03_r AV644601 741 1124
215 CM057f02_r AV390451 744 1233
216 HC086f04_r AV638455 805 1197
217 HC090h11_r AV638798 835 1197
218 CM018d06_r AV387249 863 1198
219 LC024d11_r AV620617 866 1337
220 CM034f11_r AV388674 981 1244
221 MX221a02_r BP090245 1004 1346




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research