KCC000031A_c05
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000031A_C05 KCC000031A_c05
GTTTTACGAAAACAGGCAAAGATGGGTCTGTCAGCCCCGCCCGGCTGCTACCGGCTATGT
CTAAGGGTAATGCCCTACCCGAAGTCTCGCTTCTTGCCGTGGTGTGCCCGACCCCAAGAT
CCGCATTTACGATGCGGGGTATGAAGAGGGCCGATGTGGACACCTTCCCCTGGCTGCGTC
CACCTGGCGCAGTTGGCGAGAAGGAGAACGTGACCCAGTGAGGCGCTGGAGTGCTGCCCC
GCTGCTGGCGGCTAACAAGTACATGGTGAAGAAACGCCGGAAAGGAGGCGTTCCACCTGG
CGCGTGCGCGTGGCACCCACTTCCACGTGGCTGCGCATCAACAAGATGCTTTCGTGGCGC
AGGGCGCTGATCGCCCTGCAGACCGGTATGCGTGGTGGCTTTCGGCAAGCCCAACGGCGT
CTGGCGCTCGTGTGCAGATCGGCCAGGTGCTGATGAGCATCCGCTGCCGTGACAACCACG
GTGCCTGTGGCCGCAGGAGTGCCCTGCGGCCGCGCCAAGTTCAAGTTCCCCGGGCCGGCA
GAAGATCATCCGGGTCCACACACTGGGGCTTCACCAACCTGTCCCGCAAGGACTTCAAGA
TCTTCCGCGAGGAGGGCCGCCTGATCAACGACGGCTCGCACGTCAAGGTCATCACCAACA
AGGGCCCCCTGGCCGAGCGCGAGCCCGACCACATCTTCGACTACCCCGCCTTCAAGCACC
ACACACCCCTGCACAAGGACGAGTAAACAGCTGGCGCTAGCAGCGTCGGTTGCGGAGGGC
GGCAGCAGCATCGGGCGGCGCGCCGCAGCGTGCGCGGCGTGAGCTGTGCAGGCGCGTGGC
GTGGCGTCGTTGCGGGGCCGCTCCGCCTGCACCCGTTCTGTGCTCGTGTGCGTAGTGTGC
GGCTAGGCAAGGAGGCTGTTGGTTGGCGTGAAGTGACAGGCCCGGCTGCGTGTCTTTTGC
GGGGGCGGTCTGCTGCCGTTGCAGAGGCGCTTAGTGTCGGCCGTGGGCTGGCCCCAGGCC
ACGACTGAACTGTCGGGCGTGGTAGGGTCGCTGCTGTGTTCCGCGCATGTTCCCCTGGTG
GTGCATGTTGGGGCTCATGGCGGCATACCCCACCGCGAGTCCAACGTTGGGTGGGGAAGA
GCCCCGGACTCGCCTTGTAACAAGGCGCGG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000031A_C05 KCC000031A_c05
         (1170 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P45633|RL10_MAIZE 60S RIBOSOMAL PROTEIN L10 (QM PROTEIN HOMOL...    92  2e-17
emb|CAD98460.1| ribsomal protein L10, probable [Cryptosporidium ...    67  3e-17
sp|P93847|RL10_SOLME 60S RIBOSOMAL PROTEIN L10 (EQM) gi|1902894|...    89  1e-16
ref|NP_564878.1| 60S ribosomal protein L10 (RPL10C) [Arabidopsis...    87  6e-16
gb|AAK53755.1|AF367627_1 QM-like protein [Trypanosoma brucei]          67  7e-16

>sp|P45633|RL10_MAIZE 60S RIBOSOMAL PROTEIN L10 (QM PROTEIN HOMOLOG)
           gi|7447294|pir||T02068 probable transcription factor QM
           - maize gi|468056|gb|AAA17419.1| QM protein
          Length = 220

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 74/199 (37%), Positives = 102/199 (51%), Gaps = 2/199 (1%)
 Frame = +3

Query: 108 PTPRSAFTMRGMKRADVDTFPWLRPPGAVGEKENVTQ*GAGVLPRCWRLTSTW*RNAGKE 287
           P P+      GMKR  VD FP+     +  E+ENV+               T  ++AGK+
Sbjct: 27  PDPKIRIYDVGMKRKGVDEFPYCVHLVS-WERENVSSEALEAARIVCNKYMT--KSAGKD 83

Query: 288 AFHLARARGTHFHVAAHQQDAFVAQGADR--PADRYAWWLSASPTASGARVQIGQVLMSI 461
           AFHL R R   FHV    +    A GADR     R A+     P  + ARV IGQVL+S+
Sbjct: 84  AFHL-RVRVHPFHVLRINKMLSCA-GADRLQTGMRGAF---GKPQGTCARVDIGQVLLSV 138

Query: 462 RCRDNHGACGRRSALRPRQVQVPRAGRRSSGSTHWGFTNLSRKDFKIFREEGRLINDGSH 641
           RC+DN+ A     ALR  + + P A ++   S  WGFT  SR D+  ++ EGR++ DG +
Sbjct: 139 RCKDNNAAHASE-ALRRAKFKFP-ARQKIIESRKWGFTKFSRADYLKYKSEGRIVPDGVN 196

Query: 642 VKVITNKGPLAEREPDHIF 698
            K++ N G L +R P   F
Sbjct: 197 AKLLANHGRLEKRAPGKAF 215

 Score = 41.2 bits (95), Expect = 0.035
 Identities = 27/64 (42%), Positives = 31/64 (48%), Gaps = 1/64 (1%)
 Frame = +2

Query: 95  CRGVPDPKIRIYDAGYEEGRCGHLPLAASTWRSWREGERDPVRRWS-AAPLLAANKYMVK 271
           CRGVPDPKIRIYD G +       P       SW   ER+ V   +  A  +  NKYM K
Sbjct: 23  CRGVPDPKIRIYDVGMKRKGVDEFPYCVHL-VSW---ERENVSSEALEAARIVCNKYMTK 78

Query: 272 KRRK 283
              K
Sbjct: 79  SAGK 82

>emb|CAD98460.1| ribsomal protein L10, probable [Cryptosporidium parvum]
          Length = 222

 Score = 67.0 bits (162), Expect(2) = 3e-17
 Identities = 53/140 (37%), Positives = 77/140 (54%), Gaps = 3/140 (2%)
 Frame = +3

Query: 279 GKEAFHLARARGTHFHVAAHQQDAFVAQGADR--PADRYAWWLSASPTASGARVQIGQVL 452
           GK+ FHL R R   FHV    +    A GADR     R A+     PT + ARV IGQVL
Sbjct: 81  GKDNFHL-RIRVHPFHVLRINKMLSCA-GADRLQTGMRGAY---GKPTGTAARVNIGQVL 135

Query: 453 MSIRCRDNHGACGRRSALRPRQVQVPRAGRRSSG-STHWGFTNLSRKDFKIFREEGRLIN 629
           MSIRC+++        ALR  + + P  GR+    S  WGFT  +++++  ++ EGR++ 
Sbjct: 136 MSIRCKEDKTQTAVM-ALRRAKYKFP--GRQKVVVSDKWGFTKFTKEEYLKYQAEGRIVP 192

Query: 630 DGSHVKVITNKGPLAEREPD 689
           DG + K I+ +G L+   P+
Sbjct: 193 DGVNCKYISCRGSLSRIFPE 212

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 62/173 (35%), Positives = 77/173 (43%), Gaps = 7/173 (4%)
 Frame = +1

Query: 37  PPGCYRLCLRVMPYPKSRFLPWCARPQDPHLRC-GV*RGPMWTPS-PGCVHLAQLARRRT 210
           P  CYR C R  PYPKSRF   C    DP +R   V R      + P  +HL      + 
Sbjct: 5   PARCYRYC-RGKPYPKSRF---CRGVPDPKIRIYDVGRKKAECDAFPAVIHLISDEYEQI 60

Query: 211 *PSEALECCPAAGG*QVHGEETPERRRSTWRVRVAPTSTWLRINKMLSWRRALIALQTGM 390
             SEALE    +     +  +   +     R+RV P    LRINKMLS   A   LQTGM
Sbjct: 61  -SSEALEAARISA--NKYMIKFCGKDNFHLRIRVHPFHV-LRINKMLSCAGA-DRLQTGM 115

Query: 391 RGGFRQ-----AQRRLALVCRSARC**ASAAVTTTVPVAAGVPCGRAKFKFPG 534
           RG + +     A+  +  V  S RC       T T  +A      RAK+KFPG
Sbjct: 116 RGAYGKPTGTAARVNIGQVLMSIRC---KEDKTQTAVMA----LRRAKYKFPG 161

 Score = 44.7 bits (104), Expect(2) = 3e-17
 Identities = 26/59 (44%), Positives = 32/59 (54%)
 Frame = +2

Query: 95  CRGVPDPKIRIYDAGYEEGRCGHLPLAASTWRSWREGERDPVRRWSAAPLLAANKYMVK 271
           CRGVPDPKIRIYD G ++  C   P          E E+       AA  ++ANKYM+K
Sbjct: 23  CRGVPDPKIRIYDVGRKKAECDAFPAVIHLISD--EYEQISSEALEAA-RISANKYMIK 78

>sp|P93847|RL10_SOLME 60S RIBOSOMAL PROTEIN L10 (EQM) gi|1902894|dbj|BAA19462.1| QM
           family protein [Solanum melongena]
          Length = 219

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 77/203 (37%), Positives = 102/203 (49%), Gaps = 6/203 (2%)
 Frame = +3

Query: 108 PTPRSAFTMRGMKRADVDTFPWLRPPGAVGEKENVTQ*GAGVLPRCWRLTSTW*RNAGKE 287
           P P+      GMKR  VD FP+     +  EKENV+               T  ++AGK+
Sbjct: 27  PDPKIRIYDVGMKRKGVDEFPFCVHLVS-WEKENVSSEALEAARIACNKYMT--KSAGKD 83

Query: 288 AFHLARARGTHFHVAAHQQDAFVAQGADR--PADRYAWWLSASPTASGARVQIGQVLMSI 461
           AFHL R R   FHV    +    A GADR     R A+     P    ARV IGQVL+S+
Sbjct: 84  AFHL-RVRVHPFHVLRINKMLSCA-GADRLQTGMRGAF---GKPQGVCARVAIGQVLLSV 138

Query: 462 RCRD---NHGACGRRSALRPRQVQVPRAGRRSS-GSTHWGFTNLSRKDFKIFREEGRLIN 629
           RC+D   NH     + ALR  + + P  GR+    S  WGFT  SR D+  ++ E R++ 
Sbjct: 139 RCKDGNSNHA----QEALRRAKFKFP--GRQKIIVSRKWGFTKFSRTDYLKYKSENRIVP 192

Query: 630 DGSHVKVITNKGPLAEREPDHIF 698
           DG + K++ N GPLA R+P   F
Sbjct: 193 DGVNAKLLGNHGPLAARQPGRAF 215

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 66/174 (37%), Positives = 81/174 (45%), Gaps = 8/174 (4%)
 Frame = +1

Query: 37  PPGCYRLCLRVMPYPKSRFLPWCARPQDPHLR---CGV*RGPMWTPSPGCVHLAQLARRR 207
           P  CYR  ++  PYPKSRF   C    DP +R    G+ R  +    P CVHL    +  
Sbjct: 5   PARCYRQ-IKNKPYPKSRF---CRGVPDPKIRIYDVGMKRKGV-DEFPFCVHLVSWEKEN 59

Query: 208 T*PSEALECCPAAGG*QVHGEETPERRRSTWRVRVAPTSTWLRINKMLSWRRALIALQTG 387
              SEALE    A     +  ++  +     RVRV P    LRINKMLS   A   LQTG
Sbjct: 60  V-SSEALEAARIAC--NKYMTKSAGKDAFHLRVRVHPFHV-LRINKMLSCAGA-DRLQTG 114

Query: 388 MRGGFRQAQ---RRLAL--VCRSARC**ASAAVTTTVPVAAGVPCGRAKFKFPG 534
           MRG F + Q    R+A+  V  S RC   ++         A     RAKFKFPG
Sbjct: 115 MRGAFGKPQGVCARVAIGQVLLSVRCKDGNSN-------HAQEALRRAKFKFPG 161

 Score = 42.0 bits (97), Expect = 0.021
 Identities = 27/64 (42%), Positives = 32/64 (49%), Gaps = 1/64 (1%)
 Frame = +2

Query: 95  CRGVPDPKIRIYDAGYEEGRCGHLPLAASTWRSWREGERDPVRRWS-AAPLLAANKYMVK 271
           CRGVPDPKIRIYD G +       P       SW   E++ V   +  A  +A NKYM K
Sbjct: 23  CRGVPDPKIRIYDVGMKRKGVDEFPFCVHL-VSW---EKENVSSEALEAARIACNKYMTK 78

Query: 272 KRRK 283
              K
Sbjct: 79  SAGK 82

>ref|NP_564878.1| 60S ribosomal protein L10 (RPL10C) [Arabidopsis thaliana]
           gi|14194141|gb|AAK56265.1|AF367276_1 At1g66580/T12I7_3
           [Arabidopsis thaliana] gi|15777885|gb|AAL05903.1|
           At1g66580/T12I7_3 [Arabidopsis thaliana]
           gi|21593025|gb|AAM64974.1| 60S ribosomal protein L10,
           putative [Arabidopsis thaliana]
          Length = 221

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 75/200 (37%), Positives = 99/200 (49%), Gaps = 3/200 (1%)
 Frame = +3

Query: 108 PTPRSAFTMRGMKRADVDTFPWLRPPGAVGEKENVTQ*GAGVLPRCWRLTSTW*RNAGKE 287
           P P+      GMKR  VD FP+     +  EKENV+                  ++AGK+
Sbjct: 27  PDPKIRIYDVGMKRKGVDEFPFCVHLVS-WEKENVSSEALEAARIACNKYMV--KSAGKD 83

Query: 288 AFHLARARGTHFHVAAHQQDAFVAQGADRPADRYAWWLSASPTASG--ARVQIGQVLMSI 461
           AFHL R R   FHV    +    A GADR          A   A G  ARV IGQVL+S+
Sbjct: 84  AFHL-RIRVHPFHVLRINKMLSCA-GADR---LQTGMRGAFGKALGTCARVAIGQVLLSV 138

Query: 462 RCRDNHGACGRRSALRPRQVQVPRAGRRSS-GSTHWGFTNLSRKDFKIFREEGRLINDGS 638
           RC+DNHG   +  ALR  + + P  GR+    S  WGFT  +R ++   R   R++ DG 
Sbjct: 139 RCKDNHGVHAQE-ALRRAKFKFP--GRQKIIVSRKWGFTKFNRAEYTKLRAMKRIVPDGV 195

Query: 639 HVKVITNKGPLAEREPDHIF 698
           + K ++N GPLA R+P   F
Sbjct: 196 NAKFLSNHGPLANRQPGSAF 215

 Score = 43.5 bits (101), Expect = 0.007
 Identities = 28/64 (43%), Positives = 33/64 (50%), Gaps = 1/64 (1%)
 Frame = +2

Query: 95  CRGVPDPKIRIYDAGYEEGRCGHLPLAASTWRSWREGERDPVRRWS-AAPLLAANKYMVK 271
           CRGVPDPKIRIYD G +       P       SW   E++ V   +  A  +A NKYMVK
Sbjct: 23  CRGVPDPKIRIYDVGMKRKGVDEFPFCVHL-VSW---EKENVSSEALEAARIACNKYMVK 78

Query: 272 KRRK 283
              K
Sbjct: 79  SAGK 82

>gb|AAK53755.1|AF367627_1 QM-like protein [Trypanosoma brucei]
          Length = 213

 Score = 67.0 bits (162), Expect(2) = 7e-16
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 3/137 (2%)
 Frame = +3

Query: 270 RNAGKEAFHLARARGTHFHVAAHQQDAFVAQGADR--PADRYAWWLSASPTASGARVQIG 443
           + A KE FH+ R R   FHV    +    A GADR     R ++     P  + ARV+IG
Sbjct: 78  KRANKECFHM-RIRAHPFHVLRINKMLSCA-GADRLQTGMRQSY---GKPNGTCARVRIG 132

Query: 444 QVLMSIRCRDNHGACGRRSALRPRQVQVPRAGRRSSG-STHWGFTNLSRKDFKIFREEGR 620
           Q+L+S+R +D +      S LR  +++ P  GR+    S +WGFTN+ R +++  R+ G+
Sbjct: 133 QILLSMRTKDTYVPQALES-LRRAKMKFP--GRQIIVISKYWGFTNILRNEYEELRDAGK 189

Query: 621 LINDGSHVKVITNKGPL 671
           L   G HVK+IT KG +
Sbjct: 190 LQQRGLHVKLITPKGKI 206

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 61/173 (35%), Positives = 76/173 (43%), Gaps = 7/173 (4%)
 Frame = +1

Query: 37  PPGCYRLCLRVMPYPKSRFLPWCARPQDPHLR---CGV*RGPMWTPSPGCVHLAQLARRR 207
           P  CYR C +  PYPKSRF   C    DP +R    G  R P+    P CVH+      +
Sbjct: 5   PARCYRFC-KNKPYPKSRF---CRGVPDPRIRTFDIGKRRAPV-DEFPVCVHVVSRELEQ 59

Query: 208 T*PSEALECCPAAGG*QVHGEETPERRRST----WRVRVAPTSTWLRINKMLSWRRALIA 375
              SEALE        ++   +   +R +      R+R  P    LRINKMLS   A   
Sbjct: 60  I-SSEALEAA------RIQANKYMVKRANKECFHMRIRAHPFHV-LRINKMLSCAGA-DR 110

Query: 376 LQTGMRGGFRQAQRRLALVCRSARC**ASAAVTTTVPVAAGVPCGRAKFKFPG 534
           LQTGMR  + +     A V R  +   +     T VP A      RAK KFPG
Sbjct: 111 LQTGMRQSYGKPNGTCARV-RIGQILLSMRTKDTYVPQAL-ESLRRAKMKFPG 161

 Score = 40.0 bits (92), Expect(2) = 7e-16
 Identities = 25/63 (39%), Positives = 31/63 (48%)
 Frame = +2

Query: 95  CRGVPDPKIRIYDAGYEEGRCGHLPLAASTWRSWREGERDPVRRWSAAPLLAANKYMVKK 274
           CRGVPDP+IR +D G         P+        RE E+       AA  + ANKYMVK+
Sbjct: 23  CRGVPDPRIRTFDIGKRRAPVDEFPVCVHVVS--RELEQISSEALEAA-RIQANKYMVKR 79

Query: 275 RRK 283
             K
Sbjct: 80  ANK 82



EST assemble image


clone accession position
1 MX221d01_r BP090269 1 605
2 HC060b01_r AV636483 19 748
3 HC047g03_r AV635548 21 854
4 HC090c10_r AV638749 21 723
5 HC088e09_r AV638612 22 558
6 HC058e12_r AV636367 22 762
7 HC009h05_r AV632577 22 748
8 HC077b12_r AV637763 22 747
9 HC017e04_r AV633161 22 620
10 LC078f10_r AV624509 23 764
11 HC029b12_r AV634096 24 476
12 HC051h01_r AV635854 26 441
13 HC020c06_r AV633389 27 828
14 HC051a06_r AV635790 28 775
15 MX206f11_r BP089407 28 661
16 HC079h11_r AV637958 29 829
17 HC041g04_r AV635090 29 698
18 MX217f11_r BP090025 29 605
19 HC005b02_r AV632189 30 787
20 HC063b09_r AV636707 30 777
21 HC016g09_r AV633105 30 294
22 LC083g09_r AV624867 32 856
23 HC060h10_r AV636548 33 785
24 HC011h05_r AV632728 34 768
25 HC057a10_r AV636251 34 791
26 LC087b07_r AV625050 35 812
27 MX007h02_r BP086392 35 289
28 LC085d11_r AV624989 36 830
29 LC073f04_r AV624150 36 785
30 HC048a09_r AV635574 37 807
31 HC062e03_r AV636658 37 743
32 HC054h05_r AV636076 37 454
33 LC036g12_r AV621489 37 822
34 LC052h01_r AV622673 37 816
35 HC047g09_r AV635553 38 804
36 HC079c11_r AV637915 38 673
37 HC060d11_r AV636508 38 678
38 LC039a12_r AV621650 38 846
39 LC053g06_r AV622737 38 870
40 LC090f08_r AV625303 38 838
41 CL71d06_r AV396891 39 707
42 LC041h10_r AV621865 39 821
43 LC001c08_r AV618914 39 858
44 HC020f02_r AV633420 39 755
45 HC088f06_r AV638621 39 745
46 HC036d10_r AV634682 40 814
47 HC063f12_r AV636750 40 746
48 LC037b03_r AV621513 41 816
49 LC038g05_r AV621632 41 743
50 MX217b03_r BP089992 41 547
51 HC076b03_r AV637676 42 784
52 MX213b11_r BP089742 42 590
53 LC045d03_r AV622267 42 867
54 LC090d09_r AV625286 42 869
55 MX214b06_r BP089804 43 697
56 LC048d11_r AV622347 44 814
57 HC095e08_r AV639145 46 812
58 LC041e01_r AV621828 49 850
59 LC033d12_r AV621254 49 811
60 LC011e10_r AV619669 49 850
61 LC049d07_r AV622416 50 870
62 LC012a11_r AV619709 50 775
63 HC041f05_r AV635080 51 828
64 HC028d02_r AV634031 52 848
65 HC071h03_r AV637339 52 869
66 CM098b09_r AV392903 53 824
67 CL72d07_r AV397026 53 501
68 HC056f10_r AV636222 56 710
69 MXL052f10_r BP096100 67 820
70 LC041b11_r AV621806 76 874
71 HC031h03_r AV634319 78 854
72 LC025f01_r AV620694 94 791
73 HC015b09_r AV632983 95 727
74 HC017a04_r AV633119 101 904
75 MX215e12_r BP089893 101 731
76 LC050h05_r AV622529 108 865
77 MX203g06_r BP089251 109 638
78 MX228h02_r BP090766 109 523
79 MX249a10_r BP092050 110 866
80 LCL050c12_r AV629009 116 807
81 CM011a06_r AV386925 117 677
82 HC018g07_r AV633270 118 700
83 HC096a08_r AV639184 119 829
84 CM088c03_r AV393029 120 885
85 CM031a03_r AV388296 120 845
86 CM053e02_r AV389918 120 845
87 CM056c07_r AV390302 120 896
88 CM004c03_r AV386633 120 835
89 CM094f02_r AV393275 120 810
90 CM082g11_r AV392130 120 694
91 CM066h08_r AV390822 120 933
92 CM059d08_r AV390674 120 843
93 CM062b05_r AV390131 120 942
94 CM065e02_r AV391155 120 895
95 CM077f04_r AV391758 120 900
96 CM078b11_r AV391853 120 931
97 CM027d04_r AV387614 120 884
98 CM020c10_r AV397440 120 898
99 CM042g05_r AV389279 120 494
100 CM049b12_r AV389611 120 461
101 CM050d02_r AV389737 120 436
102 CM062e11_r AV390127 120 930
103 CM078f01_r AV391814 121 911
104 LC081d12_r AV624705 121 807
105 LC027a03_r AV620797 121 830
106 CM071h07_r AV391327 121 908
107 CM094c06_r AV393276 124 828
108 CM087f11_r AV392483 124 827
109 CM032a10_r AV388516 125 847
110 CM095b11_r AV392719 125 773
111 CM054f09_r AV389997 125 508
112 CM016f02_r AV387470 125 899
113 CM030e07_r AV397430 125 387
114 CM037g05_r AV388865 125 842
115 CM061d09_r AV390591 125 885
116 CM001g08_r AV386471 125 831
117 CM066d12_r AV390837 125 913
118 CM078b06_r AV391806 126 890
119 CM098a11_r AV392895 126 779
120 CM085b07_r AV392349 126 826
121 CM070d08_r AV391306 126 951
122 CM066c08_r AV390818 127 921
123 MX222g02_r BP090355 127 578
124 MX226c06_r BP090599 127 612
125 CM012f04_r AV387189 127 828
126 CM090d10_r AV392303 127 803
127 MX215f12_r BP089900 127 753
128 CM020e10_r AV397479 128 890
129 CM034e04_r AV388611 128 761
130 CM036g04_r AV388822 128 670
131 CM065b08_r AV391142 128 930
132 MX241c12_r BP091583 128 810
133 MX232c04_r BP090997 128 474
134 CM093e11_r AV392999 128 732
135 CM077g04_r AV391759 128 941
136 MX256h10_r BP092631 128 802
137 CM079e10_r AV391987 129 916
138 CM077g01_r AV391748 129 828
139 MX230b07_r BP090857 129 392
140 CM031b02_r AV388316 129 838
141 CM043b11_r AV389516 129 508
142 CM016b10_r AV387451 129 888
143 CM054e10_r AV390002 129 289
144 CM099h07_r AV393120 130 828
145 MX024a08_r BP087058 130 769
146 CM076b01_r AV391672 130 965
147 CM021a11_r AV387904 130 874
148 HC089h02_r AV638715 130 744
149 HC012a05_r AV632740 130 722
150 MX224a10_r BP090449 130 711
151 CM020h06_r AV397452 130 935
152 CM085d05_r AV392355 130 700
153 MX041b07_r BP087675 130 642
154 CM019g04_r AV387324 130 830
155 CM037a01_r AV388831 131 720
156 CM056g06_r AV390280 131 780
157 HC003d01_r AV632055 131 819
158 HC091g09_r AV638863 131 609
159 HC007c11_r AV632368 131 821
160 CM052c02_r AV390497 131 833
161 MX051b05_r BP088084 131 644
162 CM006d10_r AV387197 131 752
163 CM040e08_r AV389214 131 840
164 CM032f11_r AV388495 131 837
165 MX018c08_r BP086845 131 660
166 MXL089e09_r BP098218 131 666
167 HC066a02_r AV636912 131 731
168 LC057a05_r AV622953 131 827
169 HC058d05_r AV636350 132 862
170 HC030e07_r AV634207 132 857
171 LC042a01_r AV621867 132 856
172 CM076h07_r AV391715 132 940
173 LC084b07_r AV624890 132 855
174 CL65g10_r AV396570 132 854
175 HC022e10_r AV633581 132 852
176 LC019d09_r AV620241 132 851
177 LC018e08_r AV620170 132 850
178 HC047f03_r AV635538 132 849
179 CM087a02_r AV392458 132 872
180 CM035d06_r AV388743 132 844
181 HC005f09_r AV632239 132 849
182 CM044f04_r AV389553 132 842
183 CM012f01_r AV387165 132 841
184 LC072a05_r AV624033 132 840
185 HC074f04_r AV637556 132 839
186 LC090b04_r AV625263 132 838
187 HC014g11_r AV632952 132 840
188 LC084a02_r AV624878 132 836
189 CM035e03_r AV388693 132 837
190 CM100b05_r AV392835 132 835
191 LC007d12_r AV619374 132 850
192 HC003e01_r AV632065 132 855
193 LC049a07_r AV622388 132 831
194 HC072h01_r AV637411 132 830
195 LC050b08_r AV622470 132 829
196 LC090c07_r AV625276 132 828
197 LC064a05_r AV623453 132 829
198 CM092h05_r AV392666 132 824
199 LC088f05_r AV625158 132 821
200 HC004f03_r AV632155 132 822
201 LC060d03_r AV623204 132 818
202 LC040b08_r AV621723 132 816
203 MX026g10_r BP087151 132 814
204 MX058b12_r BP088343 132 812
205 HC097a08_r AV639257 132 811
206 LC097h09_r AV625795 132 813
207 HC030c12_r AV634190 132 809
208 LC006e03_r AV619311 132 804
209 HC003e05_r AV632068 132 821
210 HC006b10_r AV632276 132 802
211 LC017f12_r AV620112 132 799
212 LC009h04_r AV619550 132 801
213 LC046a06_r AV622165 132 793
214 HC049d03_r AV635671 132 792
215 HC081d02_r AV638061 132 791
216 LC030h03_r AV621074 132 786
217 HC073e06_r AV637470 132 782
218 HC048c06_r AV635593 132 780
219 MX033e08_r BP087389 132 778
220 HC078e02_r AV637852 132 776
221 HC096d04_r AV639209 132 775
222 MX060h08_r BP088457 132 774
223 LC097d02_r AV625750 132 773
224 HC060f09_r AV636529 132 771
225 HC051c04_r AV635807 132 772
226 LC030b04_r AV621026 132 774
227 HC076h07_r AV637741 132 769
228 LC012h09_r AV619767 132 792
229 LC078c08_r AV624479 132 765
230 LC067e04_r AV623702 132 762
231 HC040f08_r AV635001 132 761
232 CM032c08_r AV388531 132 758
233 HC068c06_r AV637069 132 757
234 HC079g07_r AV637948 132 755
235 HC062e04_r AV636659 132 752
236 HC076f03_r AV637716 132 751
237 MXL011g09_r BP093669 132 748
238 LCL093g06_r AV631429 132 747
239 HC068g05_r AV637102 132 748
240 LC091g07_r AV625381 132 747
241 CL12g02_r AV393817 132 745
242 MX207g06_r BP089461 132 744
243 HC065h05_r AV636905 132 743
244 HC095d07_r AV639135 132 742
245 HC015g06_r AV633024 132 740
246 MX062a07_r BP088501 132 739
247 MX008b03_r BP086404 132 735
248 HC085a05_r AV638328 132 734
249 MX003d09_r BP086180 132 730
250 CM099h12_r AV393161 132 729
251 MX014g02_r BP086702 132 726
252 MXL023g06_r BP094483 132 727
253 MX001d07_r BP086074 132 720
254 MX011h02_r BP086573 132 721
255 HC035f05_r AV634615 132 717
256 LC017e03_r AV620093 132 721
257 CM048h03_r AV389074 132 715
258 MX034h05_r BP087455 132 712
259 CM038b07_r AV389060 132 711
260 HC096a11_r AV639187 132 709
261 HC060c12_r AV636501 132 708
262 LC061b05_r AV623255 132 707
263 LC017b01_r AV620063 132 710
264 HC082c04_r AV638124 132 706
265 MXL056b05_r BP096295 132 704
266 MX003d06_r BP086178 132 703
267 MXL042c11_r BP095468 132 702
268 MXL057f05_r BP096369 132 698
269 LC046f08_r AV622213 132 697
270 MX016b04_r BP086756 132 695
271 LC070e02_r AV623918 132 690
272 HC008a12_r AV632426 132 689
273 MX056e05_r BP088289 132 694
274 LC094e05_r AV625551 132 681
275 LC098e06_r AV625833 132 680
276 MX014a02_r BP086665 132 679
277 LC100c11_r AV625957 132 678
278 HC053e08_r AV635974 132 676
279 HC009c04_r AV632520 132 680
280 MX010h08_r BP086535 132 673
281 HC020h04_r AV633445 132 675
282 LC100f06_r AV625979 132 676
283 CM039d01_r AV388956 132 667
284 CM042d02_r AV389252 132 666
285 LC098h10_r AV625856 132 664
286 LC096d02_r AV625678 132 663
287 CM042g12_r AV389298 132 666
288 MX208c11_r BP089489 132 657
289 MX208d01_r BP089490 132 656
290 MX057f08_r BP088329 132 653
291 MX208e11_r BP089499 132 651
292 MX043f03_r BP087786 132 654
293 MX064c02_r BP088583 132 650
294 MX012f08_r BP086604 132 642
295 MX204h09_r BP089316 132 635
296 MX046a07_r BP087898 132 630
297 LC094e07_r AV625553 132 630
298 MX059g08_r BP088412 132 626
299 MX205a05_r BP089319 132 616
300 HC093d02_r AV638978 132 615
301 HC062f09_r AV636673 132 606
302 LC091f12_r AV625375 132 600
303 MX065f02_r BP088638 132 517
304 CM042e02_r AV389253 132 490
305 MX003e11_r BP086186 132 485
306 HC030d02_r AV634192 132 486
307 CM007c10_r AV386844 132 368
308 CM071c07_r AV391321 132 948
309 CM057a05_r AV390466 132 928
310 CM089e11_r AV392239 132 805
311 CM023c07_r AV387746 132 907
312 CM070c02_r AV391261 132 853
313 CM064f03_r AV390949 132 831
314 CM072a06_r AV391463 132 736
315 CM062g12_r AV390116 132 820
316 LC011g03_r AV619685 132 889
317 CM088e11_r AV393023 132 927
318 CM024h04_r AV388294 132 920
319 CM099g03_r AV393117 132 860
320 LC084h05_r AV624945 132 827
321 HC038e10_r AV634832 132 813
322 CM062h01_r AV390168 132 944
323 CM065c09_r AV391132 132 923
324 LC002c12_r AV618991 132 896
325 HC002a10_r AV631947 132 842
326 LC037a10_r AV621509 132 832
327 CM071f04_r AV391378 132 969
328 CM069c03_r AV391198 132 940
329 CM085d03_r AV392389 132 844
330 HC020f12_r AV633430 132 652
331 HC002h07_r AV632017 132 614
332 LC063e05_r AV623417 132 826
333 MX208f11_r BP089508 132 652
334 LC011c10_r AV619652 132 907
335 CM046h07_r AV388058 132 884
336 HC058a02_r AV636322 132 527
337 LC042g06_r AV621929 132 876
338 LC031d04_r AV621111 132 876
339 LC024a08_r AV620588 132 873
340 HC084e09_r AV638297 132 870
341 LC024c06_r AV620605 132 869
342 LC018c10_r AV620153 132 869
343 CM044b12_r AV389574 132 864
344 LC024a01_r AV620581 132 892
345 CM077c10_r AV391782 132 933
346 CM062b10_r AV390142 132 931
347 LC011e04_r AV619664 132 862
348 CM082h01_r AV392093 132 885
349 LC019h05_r AV620270 132 851
350 LC008c08_r AV619432 132 871
351 CM026b04_r AV387558 132 921
352 CM089g03_r AV392232 132 901
353 HC004b12_r AV632121 132 850
354 CM064b09_r AV391004 132 926
355 LC076d03_r AV624338 132 839
356 LC089g07_r AV625241 132 814
357 CM031b10_r AV388357 132 381
358 CM015d11_r AV387419 132 939
359 CM088d11_r AV393022 132 916
360 MX023a05_r BP087020 132 753
361 LC099e03_r AV625893 132 319
362 CM009g03_r AV397680 132 922
363 CM029c12_r AV389377 132 949
364 LC088b11_r AV625124 132 441
365 CM042c09_r AV389280 132 531
366 MX028e03_r BP087229 132 337
367 CM030g11_r AV397377 132 920
368 CM058h11_r AV390416 132 946
369 CM076d12_r AV391719 132 942
370 CM055b05_r AV390249 132 901
371 CM027d08_r AV387622 132 917
372 CM024c08_r AV388252 132 910
373 MXL016d06_r BP093970 133 814
374 MX013h02_r BP086660 133 813
375 LC010c07_r AV619577 133 812
376 CM097d11_r AV393196 133 811
377 LC014f12_r AV619899 133 810
378 CM022a11_r AV387844 133 922
379 MX031c08_r BP087306 133 804
380 HC008b02_r AV632428 133 802
381 CM010e09_r AV387010 133 817
382 HC008a01_r AV632416 133 798
383 HC047h11_r AV635565 133 793
384 HC019g02_r AV633343 133 792
385 HC073d06_r AV637459 133 791
386 MX202c11_r BP089180 133 789
387 HC097e09_r AV639297 133 874
388 MX104e11_r BP089080 133 784
389 LC041a05_r AV621792 133 775
390 MX062a06_r BP088500 133 774
391 HC007f05_r AV632391 133 771
392 MXL012b03_r BP093693 133 764
393 HC074g07_r AV637567 133 761
394 HC061b08_r AV636565 133 755
395 MX053a08_r BP088161 133 751
396 LC030h05_r AV621076 133 747
397 HC052e03_r AV635904 133 746
398 HC017h12_r AV633201 133 745
399 LC068h11_r AV623808 133 854
400 MXL069e10_r BP097070 133 740
401 MX213f07_r BP089773 133 729
402 CM092h04_r AV392681 133 730
403 HC091a09_r AV638806 133 727
404 MX016c09_r BP086768 133 721
405 MX027e12_r BP087183 133 712
406 CM010g08_r AV386979 133 711
407 CM048c12_r AV389081 133 710
408 HC043h06_r AV635253 133 709
409 CM049c07_r AV389604 133 708
410 MX017f05_r BP086822 133 706
411 MX023c01_r BP087030 133 705
412 MX103e02_r BP088986 133 700
413 MX017a05_r BP086799 133 699
414 MX017g06_r BP086829 133 694
415 MX027g10_r BP087192 133 683
416 MX244a09_r BP091769 133 687
417 MX046h01_r BP087918 133 680
418 HC075c01_r AV637598 133 678
419 MXL080d03_r BP097729 133 675
420 LC050a11_r AV622461 133 675
421 CM053e12_r AV389911 133 670
422 CM054c12_r AV390032 133 668
423 MX054h03_r BP088232 133 661
424 MX061d02_r BP088474 133 660
425 MX050a11_r BP088044 133 661
426 CM076f05_r AV391681 133 745
427 MX201b07_r BP089123 133 655
428 MX059d09_r BP088397 133 651
429 LCL070a09_r AV629960 133 652
430 MX065e05_r BP088634 133 648
431 MX062g07_r BP088537 133 636
432 CM048f09_r AV389124 133 633
433 HC092d09_r AV638906 133 615
434 HC100e12_r AV639530 133 605
435 MX225c07_r BP090531 133 602
436 CM001e06_r AV386504 133 578
437 CM037g01_r AV388835 133 505
438 CM039a03_r AV388913 133 503
439 CM043d04_r AV389482 133 497
440 LCL006a10_r AV626295 133 491
441 CM041d09_r AV389399 133 481
442 HC023g01_r AV633665 133 446
443 CM071f08_r AV391383 133 938
444 LC023b12_r AV620520 133 799
445 CM001b10_r AV386535 133 895
446 CM068e09_r AV391038 133 952
447 CM080g09_r AV392055 133 945
448 CM066d11_r AV390856 133 928
449 CM051d11_r AV389880 133 889
450 LC038e06_r AV621616 133 886
451 CM022h03_r AV387837 133 938
452 HC092f10_r AV638926 133 721
453 HC011d11_r AV632694 133 874
454 CM026c08_r AV387513 133 952
455 CM074h05_r AV391579 133 959
456 CM059a10_r AV390659 133 940
457 CM073a05_r AV391429 133 964
458 CM076e12_r AV391720 133 941
459 CM020h03_r AV397485 133 914
460 CM025b11_r AV388094 133 912
461 CM023g08_r AV387764 133 903
462 CM067b07_r AV390917 133 858
463 CM059b07_r AV390683 133 857
464 CM068b10_r AV391071 133 853
465 CM071g02_r AV391340 133 840
466 CM059c07_r AV390685 133 850
467 CM071h03_r AV391322 133 797
468 CM071a03_r AV391313 133 778
469 CM060g09_r AV390747 133 845
470 CM058c05_r AV390394 133 840
471 CM055d01_r AV390247 133 838
472 CM059g07_r AV390691 133 836
473 CM078d03_r AV391840 133 827
474 CM078b05_r AV391815 133 828
475 CM025a09_r AV388099 133 828
476 CM066d07_r AV390830 133 617
477 LC048f03_r AV622359 133 856
478 HC080e04_r AV638004 133 817
479 CM056e03_r AV390266 133 926
480 LC051h08_r AV622612 133 873
481 HC021c12_r AV633482 133 885
482 CM074d07_r AV391542 133 965
483 CM025g12_r AV388128 133 944
484 CM019h06_r AV387343 133 923
485 CM030e09_r AV397395 133 955
486 LC027f09_r AV620850 133 855
487 CM029b02_r AV389308 133 940
488 LC018h03_r AV620195 133 874
489 LC046e06_r AV622203 133 542
490 CM094b01_r AV393252 133 871
491 LC089a08_r AV625187 133 870
492 LC048f01_r AV622358 133 869
493 HC064g11_r AV636831 133 862
494 LC056e06_r AV622917 133 854
495 CM089f03_r AV392231 133 900
496 LC045d12_r AV622275 133 851
497 LC032g09_r AV621214 133 852
498 LC075f12_r AV624293 133 850
499 LC023f06_r AV620554 133 852
500 LC054c09_r AV622772 133 849
501 CM044b09_r AV389536 133 845
502 CM034a11_r AV388670 133 843
503 LC074g05_r AV624229 133 843
504 LC057a08_r AV622956 133 840
505 LC020d04_r AV620309 133 839
506 CM037e05_r AV388861 133 838
507 LC014b08_r AV619859 133 837
508 CM037g12_r AV388911 133 836
509 LC013c03_r AV619791 133 877
510 LC025g12_r AV620713 133 872
511 LC036b12_r AV621442 133 842
512 CM096b07_r AV392735 133 850
513 CM040f03_r AV389163 133 835
514 LC001b09_r AV618906 133 832
515 LC004g06_r AV619175 133 832
516 MX066g08_r BP088699 133 478
517 CM034f04_r AV388613 133 833
518 CM019g01_r AV387300 133 831
519 CM093a10_r AV392981 133 835
520 HC077h06_r AV637815 133 829
521 CM059d05_r AV390649 133 688
522 CM025f07_r AV388088 133 469
523 CM026h07_r AV387524 133 925
524 LC051b10_r AV622554 133 873
525 CM075c06_r AV391652 133 975
526 CM082f09_r AV392147 133 885
527 CM028e04_r AV387680 133 953
528 CM060a11_r AV390721 133 938
529 CM077f10_r AV391784 133 956
530 CM096c05_r AV392761 133 869
531 CM030c03_r AV397422 133 961
532 CM089h09_r AV392242 133 855
533 CM089c07_r AV392261 133 927
534 HC060c08_r AV636497 133 873
535 CM014c07_r AV387410 133 927
536 CM035h11_r AV388762 133 449
537 CM018g01_r AV387290 133 939
538 CM068a03_r AV391081 133 954
539 CM073a03_r AV391396 133 953
540 CM063a09_r AV390091 133 976
541 CM030h12_r AV397355 133 954
542 LC076d02_r AV624337 133 828
543 HC015d09_r AV632999 133 748
544 CM012h08_r AV387154 133 828
545 MXL018e08_r BP094128 133 826
546 LC053h11_r AV622747 133 822
547 MX253a10_r BP092354 133 824
548 MX065b02_r BP088620 133 821
549 HC047b02_r AV635499 133 820
550 LC080e06_r AV624637 133 819
551 CM029f09_r AV389338 133 928
552 CM089d10_r AV392271 133 858
553 CM089c11_r AV392267 133 881
554 LC076g05_r AV624366 133 442
555 CM042h03_r AV389247 133 433
556 HC036a06_r AV634648 133 424
557 CM069g10_r AV391227 133 832
558 CM044f03_r AV389565 134 765
559 LC040c06_r AV621733 134 758
560 HC004c09_r AV632128 134 739
561 HC100d08_r AV639519 134 734
562 HC066b07_r AV636925 134 721
563 CM034a08_r AV388612 134 717
564 HC093d12_r AV388612 134 705
565 HC095a01_r AV639098 134 704
566 MX252f11_r BP092328 134 748
567 MX041g02_r BP087700 134 667
568 CM050g06_r AV389782 134 662
569 LC021f02_r AV620394 134 650
570 HC043f07_r AV635233 134 644
571 LC024g10_r AV620642 134 732
572 CM057c01_r AV390464 134 915
573 CM021f08_r AV387937 134 920
574 CM001f10_r AV386539 134 839
575 CM031g01_r AV388342 134 841
576 HC064e01_r AV636808 134 854
577 HC061a07_r AV636553 134 832
578 CM008a03_r AV386700 134 830
579 HC033e06_r AV634448 134 828
580 HC078d03_r AV637844 134 380
581 LCL046e08_r AV628746 134 810
582 MX202a10_r BP089171 134 804
583 HC037b06_r AV634733 134 807
584 HC004e10_r AV632150 134 792
585 MX062b10_r BP088508 134 793
586 HC071b05_r AV637285 134 767
587 CM089h06_r AV392266 134 932
588 CM029h02_r AV389316 135 926
589 CM077h08_r AV391791 135 945
590 LC072e08_r AV624069 135 824
591 LC098f05_r AV625839 135 814
592 LC077a04_r AV624380 135 609
593 CM070d06_r AV391263 135 933
594 CM077h04_r AV391760 135 889
595 CM070g04_r AV391255 135 941
596 LC085d05_r AV624984 135 765
597 MX231h08_r BP090972 135 375
598 LC069g01_r AV623865 136 814
599 CM025b03_r AV388107 136 915
600 LC051f08_r AV622592 136 853
601 LC038e03_r AV621613 136 798
602 LC040a08_r AV621714 136 792
603 LC021h11_r AV620419 136 856
604 LC007g01_r AV619391 136 780
605 HC067b04_r AV636990 136 770
606 LC048b04_r AV622322 136 855
607 HC011a04_r AV632659 136 744
608 LC045b11_r AV622254 136 737
609 LC058h11_r AV623101 136 804
610 LC002d12_r AV619001 136 747
611 LC077d06_r AV624409 136 621
612 LC092h11_r AV625462 136 547
613 CM089e06_r AV392277 136 878
614 LC041b10_r AV621805 136 822
615 LC080a07_r AV624602 136 819
616 LC047a12_r AV622245 136 851
617 LC033d05_r AV621248 136 837
618 LC024f11_r AV620635 136 828
619 CM012e09_r AV387149 137 744
620 HC005f04_r AV632235 137 827
621 LC023e02_r AV620540 137 721
622 LC036d02_r AV621453 137 888
623 CM045a01_r AV389666 137 880
624 LC027f01_r AV620843 137 870
625 LC035c10_r AV621385 137 855
626 LC024b05_r AV620597 137 850
627 HC046h01_r AV635479 137 849
628 HC028a02_r AV634002 137 832
629 HC003f02_r AV632076 137 828
630 HC042b01_r AV635117 137 825
631 LC037f04_r AV621545 137 825
632 HC069f01_r AV637162 137 673
633 MXL014f05_r BP093846 137 810
634 CM088g07_r AV393053 137 807
635 HC060d09_r AV636506 137 780
636 MX026e07_r BP087141 137 778
637 HC032c05_r AV634349 137 773
638 HC069h09_r AV637186 137 766
639 LC009h05_r AV619551 137 751
640 MX001c09_r BP086068 137 733
641 MX019g08_r BP086899 137 719
642 LC014b11_r AV619862 137 705
643 MX048e02_r BP087977 137 655
644 MX048a12_r BP087962 137 538
645 HC043f12_r AV635237 139 830
646 HC069c06_r AV637139 139 753
647 CM045g11_r AV389683 139 885
648 HC030d03_r AV634193 139 798
649 HC019e05_r AV633325 139 778
650 HC073g06_r AV637490 139 770
651 CM001c05_r AV386521 139 835
652 CM010h09_r AV387014 139 753
653 HC047e04_r AV635528 139 743
654 MX066b10_r BP088668 139 747
655 MX034c04_r BP087424 139 712
656 MXL086f08_r BP098080 139 682
657 CM048f04_r AV389141 139 618
658 LC099e01_r AV625892 139 505
659 CM028a03_r AV387683 139 901
660 HC019h02_r AV633355 140 809
661 HC095b05_r AV639112 140 804
662 HC009d10_r AV632537 140 813
663 HC062b11_r AV636639 140 801
664 MXL056h12_r BP096331 140 792
665 HC073h09_r AV637503 140 774
666 HC048e08_r AV635613 140 772
667 HC062d05_r AV636650 140 767
668 MX065h09_r BP088655 140 666
669 HC062f03_r AV636667 140 727
670 MX224a03_r BP090445 140 577
671 MX012e07_r BP086596 140 530
672 CM090h02_r AV392309 140 871
673 HC052f08_r AV635918 140 850
674 LC010g03_r AV619609 140 886
675 HC031e04_r AV634289 140 832
676 CM098h01_r AV392901 141 869
677 LC053h10_r AV622746 141 849
678 MX047g02_r BP087951 141 704
679 HC070d02_r AV637224 142 850
680 HC070g10_r AV637262 142 774
681 HC053e10_r AV635976 142 818
682 CM086d03_r AV392560 142 760
683 HC019c08_r AV633310 142 743
684 HC002h03_r AV632014 142 736
685 CM070f06_r AV391264 142 778
686 HC069c11_r AV637142 142 851
687 CM024c01_r AV388221 142 959
688 CM007e04_r AV386810 142 837
689 CM092e01_r AV392656 142 840
690 CM002h10_r AV397879 142 836
691 CM041f12_r AV389389 142 492
692 CM039c02_r AV388937 142 495
693 CM007e05_r AV386817 144 836
694 HC006h06_r AV632336 144 779
695 HC077c12_r AV637774 144 771
696 HC091a05_r AV638803 144 742
697 MX211b03_r BP089636 144 729
698 CM057d05_r AV390471 144 948
699 CM097e11_r AV393235 144 828
700 HC031d09_r AV634283 144 870
701 LC052b08_r AV622631 144 837
702 CM085e04_r AV392360 144 731
703 CM096d08_r AV392786 144 420
704 LC077g02_r AV624436 145 829
705 MX060a05_r BP088418 145 759
706 LC077b10_r AV624395 145 752
707 HC100h10_r AV639554 145 751
708 LC087e02_r AV625071 145 730
709 MX008a07_r BP086400 145 724
710 MX202a04_r BP089170 145 715
711 MX050g04_r BP088067 145 708
712 CM095e10_r AV392725 145 705
713 MX045h12_r BP087897 145 696
714 MX065g10_r BP088647 145 683
715 CM043e03_r AV389489 145 664
716 MX206g08_r BP089414 145 661
717 HC090e09_r AV638768 145 620
718 CM031d06_r AV388324 145 503
719 CM043d08_r AV389486 145 492
720 HC044c01_r AV635271 145 902
721 CM072e02_r AV391462 145 946
722 CM037d05_r AV388859 145 839
723 CM039c10_r AV388977 145 907
724 CM020e11_r AV397494 145 933
725 LC025f06_r AV620699 145 899
726 CM079c11_r AV391960 145 949
727 HC040e08_r AV634991 145 874
728 LC039f10_r AV621689 145 870
729 MX024d06_r BP087066 145 356
730 CM079e08_r AV391998 145 968
731 CM026e05_r AV387550 145 959
732 HC063c10_r AV636717 145 858
733 HC073h03_r AV637497 145 857
734 HC021e11_r AV633503 145 855
735 LC013a10_r AV619779 145 853
736 MX029a01_r BP087248 145 851
737 HC006f02_r AV632310 145 849
738 LC071c06_r AV623976 145 852
739 HC031h12_r AV634326 145 839
740 CM007f06_r AV386829 145 835
741 HC024f06_r AV633737 145 830
742 HC056f01_r AV636214 145 828
743 HC022a01_r AV633539 145 830
744 CM092d03_r AV392685 145 313
745 CM068b12_r AV391053 145 961
746 MX040a08_r BP087639 145 436
747 HC004c03_r AV632124 145 814
748 CM037c03_r AV388891 145 842
749 MX016d08_r BP086771 145 798
750 HC012e08_r AV632783 145 791
751 HC008a10_r AV632424 145 827
752 HC074h10_r AV637577 145 777
753 LC071b05_r AV623966 146 755
754 MX251f10_r BP092255 146 770
755 MX241d12_r BP091593 146 848
756 MX238b04_r BP091398 146 446
757 CM058d10_r AV390339 147 923
758 LC100h11_r AV626004 147 721
759 LCL037g09_r AV628172 147 605
760 CM003h07_r AV386598 147 444
761 CM012a09_r AV387132 147 828
762 CM012b05_r AV387166 147 833
763 LC072c08_r AV624053 149 760
764 LC032e04_r AV621190 149 853
765 CM096g12_r AV392795 149 838
766 CM035g10_r AV388726 149 658
767 LC025d03_r AV620677 149 852
768 MX259f10_r BP092826 150 729
769 HC042d10_r AV635142 150 856
770 LC089b10_r AV625199 150 869
771 CM072h04_r AV391504 150 937
772 LC064g10_r AV623506 150 779
773 CM016f01_r AV387444 152 876
774 CM098b02_r AV392925 152 832
775 LC058b09_r AV623044 153 777
776 HC091c08_r AV638822 153 739
777 HC027d04_r AV633955 153 443
778 HC073g03_r AV637487 153 805
779 CM067d01_r AV390880 153 783
780 LC016g11_r AV620044 153 675
781 LC032g06_r AV621211 153 871
782 CM040f06_r AV389180 154 818
783 CM033b06_r AV388431 154 494
784 LC077f05_r AV624427 156 862
785 HC049c12_r AV635668 156 817
786 HC028h01_r AV634070 156 848
787 LC058f11_r AV623082 157 852
788 CM001f06_r AV386505 157 828
789 HC030h11_r AV634243 157 856
790 MX010c06_r BP086501 158 732
791 MX046c07_r BP087905 158 687
792 CM039d11_r AV388950 158 918
793 HC052d10_r AV635900 158 870
794 LC090f07_r AV625302 158 872
795 LC001a02_r AV618893 158 869
796 HC050h07_r AV635785 158 857
797 HC006c01_r AV632278 158 840
798 HC090d04_r AV638755 158 767
799 HC001h03_r AV631932 158 838
800 HC100e09_r AV639528 158 825
801 LC067h02_r AV623728 158 450
802 MX003g11_r BP086197 158 810
803 HC084d04_r AV638284 158 777
804 MX058f09_r BP088363 158 682
805 HC087c06_r AV638511 158 748
806 LC066h01_r AV623656 159 887
807 CM027b06_r AV387650 160 962
808 HC027e01_r AV633964 160 873
809 HC023b01_r AV633623 160 869
810 HC009d01_r AV632529 160 851
811 CM023c08_r AV387763 160 955
812 MX055g06_r BP088265 160 675
813 CM084h04_r AV392637 161 776
814 HC085h09_r AV638402 161 870
815 HC009g06_r AV632567 161 869
816 HC008g10_r AV632484 161 891
817 HC001a11_r AV631868 161 862
818 HC042c07_r AV635130 161 850
819 HC041c08_r AV635052 161 845
820 HC029e01_r AV634115 161 840
821 HC008f04_r AV632469 161 839
822 HC064g01_r AV636822 161 814
823 HC019g07_r AV633348 161 776
824 HC051d08_r AV635822 161 746
825 MX001b08_r BP086060 161 604
826 HC033c07_r AV634430 162 850
827 CM012d07_r AV387138 162 828
828 LC018b11_r AV620146 162 915
829 CM099b02_r AV393122 162 857
830 LC023c02_r AV620522 162 810
831 LC016c01_r AV620011 162 792
832 HC094c08_r AV639044 162 764
833 CM092e07_r AV392693 162 726
834 MX043a12_r BP087760 162 694
835 CM059a02_r AV390698 163 942
836 CM086e09_r AV392534 163 905
837 HC089e12_r AV638698 163 817
838 MX044g08_r BP087845 163 690
839 MX009b10_r BP086457 163 398
840 MX060e03_r BP088435 163 721
841 HC023g03_r AV633667 164 644
842 HC009f12_r AV632561 164 829
843 HC004h07_r AV632176 164 748
844 LC091c04_r AV625347 164 655
845 LC094g05_r AV625569 164 595
846 MX068f04_r BP088773 165 668
847 MXL023d09_r BP094462 165 446
848 HC096d06_r AV639211 166 837
849 LC095h12_r AV625649 166 547
850 MX027g04_r BP087189 167 735
851 HC073a03_r AV637423 167 880
852 CM019g05_r AV387309 168 825
853 HC030e03_r AV634204 169 856
854 HC070f11_r AV637252 169 872
855 CM064d02_r AV390960 169 822
856 CM011f04_r AV386933 171 824
857 HC088d09_r AV638602 171 769
858 HC069g06_r AV637175 173 812
859 HC097f04_r AV639304 174 754
860 HC020e03_r AV633409 174 835
861 CM053a04_r AV389942 178 925
862 HC026g10_r AV633910 178 862
863 HC093h03_r AV639016 178 778
864 LC023b02_r AV620511 180 908
865 MX047a07_r BP087925 184 908
866 LC098e07_r AV625834 185 547
867 CM015h11_r AV387421 186 523
868 HC083c07_r AV638208 187 791
869 MX250c05_r BP092141 188 676
870 MXL061f12_r BP096608 188 764
871 MX032a05_r BP087331 188 742
872 MX209d11_r BP089543 189 656
873 LC071d10_r AV623989 190 816
874 MX054b01_r BP088211 194 878
875 HC005h01_r AV632251 194 792
876 MX204b10_r BP089271 194 710
877 LC085b04_r AV624965 199 479
878 LC018h01_r AV620194 199 910
879 LC067b04_r AV623674 203 804
880 LC090g05_r AV625311 203 869
881 HC031h04_r AV634320 203 695
882 LC090h08_r AV625324 204 933
883 HC013h09_r AV632885 206 901
884 CM019e02_r AV387316 207 830
885 LC023e12_r AV620549 211 944
886 LC078h11_r AV624527 211 807
887 CM007c02_r AV386794 217 956
888 LC006f01_r AV619319 217 915
889 CM019g02_r AV387321 217 822
890 HC072a02_r AV637347 218 910
891 HC008h04_r AV632490 218 915
892 LC097d01_r AV625749 223 757
893 HC092f01_r AV638919 223 916
894 HC046a11_r AV635413 225 857
895 HC077g12_r AV637812 258 850
896 CM094e02_r AV393247 259 958
897 HC031e05_r AV634290 259 915
898 CM035f10_r AV388725 259 721
899 HC021e06_r AV633499 260 874
900 HC088e08_r AV638611 260 745
901 HC093a04_r AV638949 260 888
902 CL18d08_r AV394078 262 871
903 HC078e06_r AV637856 271 843
904 HC006f10_r AV632317 271 915
905 CM002b10_r AV397868 272 997
906 LC023d06_r AV620533 272 853
907 CM057d04_r AV390419 272 926
908 CM096d01_r AV392756 272 873
909 LC049g07_r AV622440 272 985
910 CL51h11_r AV395905 280 919
911 LC050c11_r AV622485 280 1010
912 CL25a06_r AV394537 290 954
913 LC064b08_r AV623465 297 1059
914 CM012a08_r AV387129 305 994
915 CM027a10_r AV387603 305 1062
916 CM091c05_r AV397519 313 712
917 MXL093a11_r BP098421 316 903
918 HC097g12_r AV639318 322 879
919 CM086d12_r AV392495 322 867
920 HC037b07_r AV634734 328 933
921 CM091c04_r AV397536 332 778
922 CM084e11_r AV392631 332 817
923 CM084a10_r AV392618 337 831
924 LC023b04_r AV620513 338 987
925 LC066c03_r AV623608 338 1003
926 HCL060a01_r AV642889 338 894
927 CM091f11_r AV397581 338 759
928 LC038c03_r AV621595 338 793
929 CM084a12_r AV392642 338 820
930 CM091b05_r AV397517 339 730
931 CM087c11_r AV392422 340 833
932 CM085f07_r AV392350 342 777
933 CM088a01_r AV393092 344 827
934 CL60e01_r AV396376 349 1012
935 CM086e06_r AV392509 349 1034
936 CM077f01_r AV391746 349 773
937 CM099a01_r AV393131 350 970
938 CM085h05_r AV392357 350 720
939 CM051d07_r AV389858 351 1021
940 CM083d07_r AV392187 357 814
941 LC089a03_r AV625183 366 987
942 CM051a09_r AV389834 372 1058
943 CM086d09_r AV392533 375 871
944 CM091e12_r AV397560 377 831
945 CM003h11_r AV386621 381 667
946 LC051g06_r AV622598 444 1057
947 LC051g07_r AV622599 444 1037
948 LC008b11_r AV619427 444 803
949 LC042a06_r AV621870 447 1107
950 LC096b03_r AV625660 459 942
951 MX229f06_r BP090822 464 973
952 LC096h03_r AV625719 466 839
953 MX009f12_r BP086476 467 1006
954 CM091g06_r AV397577 477 1001
955 CM046d11_r AV387994 482 844
956 CM030g01_r AV397386 490 1198
957 LC020g12_r AV620343 508 1133
958 CM096b08_r AV392782 509 1009
959 CM091a10_r AV397528 518 953
960 MX258c08_r BP092727 533 974
961 LC053f06_r AV622725 546 1197
962 MXL035c05_r BP095067 586 1019
963 LC098a06_r AV625801 651 995
964 HC051f10_r AV635841 658 1140
965 CM012f06_r AV387143 687 943
966 CM083d10_r AV392185 703 1306
967 CM026f10_r AV387508 724 1256
968 CM028d03_r AV387686 857 1464
969 CL61e02_r AV396319 866 1479
970 CM066h02_r AV390849 869 1486
971 CM059d11_r AV390715 871 1474
972 CL68c04_r AV396941 896 1407
973 CL26d08_r AV394588 906 1324
974 CM037f12_r AV388910 924 1475
975 CL61c06_r AV396322 929 1474
976 MX025e10_r BP087107 937 1284
977 CL39a05_r AV395180 942 1456
978 CL50a06_r AV395724 948 1445
979 CM024g04_r AV388272 957 1499
980 CM019h07_r AV387349 973 1585
981 CL14d08_r AV393860 975 1466
982 CL50b06_r AV395726 975 1475
983 CM051c10_r AV389842 978 1480
984 CL12b06_r AV393815 986 1371
985 MX036d10_r BP087526 995 1353
986 LC087g05_r AV625091 999 1462
987 CL64g09_r AV396622 1003 1475
988 CM055f12_r AV390189 1010 1485
989 CM094h04_r AV393264 1014 1428
990 CL44g04_r AV395623 1018 1475
991 LC068d01_r AV623765 1031 1514
992 LC025d04_r AV620678 1031 1537
993 CL01g09_r AV393357 1070 1561
994 HC086h02_r AV638475 1073 1480
995 HC009b07_r AV632511 1082 1475
996 HC048h02_r AV635633 1089 1569
997 LC052f06_r AV622660 1092 1542
998 HCL001a09_r AV639563 1103 1434
999 LC083e10_r AV624848 1108 1554
1000 CM049e04_r AV389585 1240 1482
1001 CM048e09_r AV389123 1247 1482
1002 CM036g08_r AV388829 1249 1479
1003 HCL012h05_r AV640240 1351 1475




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research