KCC000030A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000030A_C01 KCC000030A_c01
GGCTGGGAACGGTGCACAACCATGGGCATCTCACGCGACTCGCTGCATAAGCGGCGCGCC
ACGGGCGGCCGCAAGGAAGCACTGGCGCAAGAAGAAGAAGTATGAGATGGGCCGTGTGCC
GGCTAACACCAAGCTGAGCAGCCAAGCGTGGCTGTCCGGACAGTGCGCGTGCGCGGTGGG
CACACCAAGTTCCGCGCTCTCCGCCTGGACACTGGCAACTACTCGTGGGGCTCGGAGGCC
GTCACCCGCAAGGTGCGCATCCTGGACGTGGTCTACAACGCGTCCAACAACGAGCTGGTG
CGCACCCAGACGCTGGTGAAGAACGCCATCGTCCAGGTGGACGCCACGCCCTTCAAGCAG
TGGTACCAGAAGCACTACAACGTGGAGCTGGGCGCCAAGAACCAGGCCGAGATTGTCCCT
AAGCCGGAGGAGATTAAGGGCTCGAACCACGTCAAGCGGAAGATCAAGGAGCGCCTGCAG
AAGCGCAAGCTGGACTCGCACCTGGCTGAGCAGTTCTCGACCGGCCGCCTGTTCGCGTGC
ATCTCGTCGCGCCCCGGCCAGTGCGGCCGCTGCGACGGCTACATCCTGGAGGGCAAGGAG
CTCGAGTTCTACGTGAAGAAGATGCAGAAGAAGAAGTCGAAGGCCGCCTAAGGGTGTGGC
CGACGACTAAGGAGCGCCAGCGGAGGTGGCGCAAGCCCCTCAAGCAGACGTGTAACGACC
CATGGTCTAGAAAAAaaaaaaaaaaaaaactcgagactagttctctctctc


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000030A_C01 KCC000030A_c01
         (771 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAE05511.1| OSJNBa0038P21.4 [Oryza sativa (japonica cultivar...   271  1e-71
sp|P49199|RS8_ORYSA 40S RIBOSOMAL PROTEIN S8 gi|7440236|pir||T04...   268  7e-71
sp|Q08069|RS8_MAIZE 40S ribosomal protein S8 gi|7440237|pir||T04...   268  9e-71
ref|NP_200732.2| 40S ribosomal protein S8 (RPS8B) [Arabidopsis t...   267  1e-70
ref|NP_197529.1| 40S ribosomal protein S8 (RPS8A) [Arabidopsis t...   267  1e-70

>emb|CAE05511.1| OSJNBa0038P21.4 [Oryza sativa (japonica cultivar-group)]
          Length = 221

 Score =  271 bits (692), Expect = 1e-71
 Identities = 142/220 (64%), Positives = 165/220 (74%), Gaps = 11/220 (5%)
 Frame = +1

Query: 22  MGISRDSLHKRRATGGRKEALAQEEEV*DGPCAG*HQAEQPSVAVRTVRVRGGHTKFRAL 201
           MGISRDS+HKRRATGG+++A  ++ +   G     +     +  VR VRVRGG+ K+RAL
Sbjct: 1   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPA-NTKLSSNKTVRRVRVRGGNLKWRAL 59

Query: 202 RLDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATPFKQWYQKHYN 381
           RLDTGNYSWGSEAVTRK RILDVVYNASNNELVRTQTLVK+AIVQVDA PFKQWY  HY 
Sbjct: 60  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYG 119

Query: 382 VELGAKNQAEIVPK-----------PEEIKGSNHVKRKIKERLQKRKLDSHLAEQFSTGR 528
           V++G K +A    K            EE K SNHV RK+++R Q R LDSH+ EQF +GR
Sbjct: 120 VDIGRKKKAPAAKKDAAEGQEGEAATEEAKKSNHVVRKLEKRQQTRTLDSHIEEQFGSGR 179

Query: 529 LFACISSRPGQCGRCDGYILEGKELEFYVKKMQKKKSKAA 648
           L ACISSRPGQCGR DGYILEGKELEFY+KK+Q+KK K A
Sbjct: 180 LLACISSRPGQCGRADGYILEGKELEFYMKKLQRKKGKGA 219

>sp|P49199|RS8_ORYSA 40S RIBOSOMAL PROTEIN S8 gi|7440236|pir||T04082 probable ribosomal
           protein S8 - rice gi|968902|dbj|BAA07207.1| ribosomal
           protein S8 [Oryza sativa (japonica cultivar-group)]
          Length = 220

 Score =  268 bits (685), Expect = 7e-71
 Identities = 140/219 (63%), Positives = 165/219 (74%), Gaps = 10/219 (4%)
 Frame = +1

Query: 22  MGISRDSLHKRRATGGRKEALAQEEEV*DGPCAG*HQAEQPSVAVRTVRVRGGHTKFRAL 201
           MGISRDS+HKRRATGG+++A  ++ +   G     +     +  VR VRVRGG+ K+RAL
Sbjct: 1   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPA-NTKLSSNKTVRRVRVRGGNVKWRAL 59

Query: 202 RLDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATPFKQWYQKHYN 381
           RLDTGNYSWGSEAVTRK RILDVVYNASNNELVRTQTLVK+AIVQVDA PFKQWY  HY 
Sbjct: 60  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYG 119

Query: 382 VELGAKNQAEIVPK----------PEEIKGSNHVKRKIKERLQKRKLDSHLAEQFSTGRL 531
           V++G K +    P+           EE K SNHV RK+++R Q R LD+H+ EQF +GRL
Sbjct: 120 VDIGRKKKEPPHPRGCCGQDAEATTEEAKKSNHVVRKLEKRQQGRTLDAHIEEQFGSGRL 179

Query: 532 FACISSRPGQCGRCDGYILEGKELEFYVKKMQKKKSKAA 648
            ACISSRPGQCGR DGYILEGKELEFY+KK+Q+KK K A
Sbjct: 180 LACISSRPGQCGRADGYILEGKELEFYMKKLQRKKGKGA 218

>sp|Q08069|RS8_MAIZE 40S ribosomal protein S8 gi|7440237|pir||T04088 ribosomal protein
           S8 - maize gi|1498053|gb|AAB06330.1| ribosomal protein
           S8
          Length = 221

 Score =  268 bits (684), Expect = 9e-71
 Identities = 139/220 (63%), Positives = 165/220 (74%), Gaps = 11/220 (5%)
 Frame = +1

Query: 22  MGISRDSLHKRRATGGRKEALAQEEEV*DGPCAG*HQAEQPSVAVRTVRVRGGHTKFRAL 201
           MGISRDS+HKRRATGG+++A  ++ +   G     +     +  VR VRVRGG+ K+RAL
Sbjct: 1   MGISRDSMHKRRATGGKQKAWRKKRKYELGRQPA-NTKLSSNKTVRRVRVRGGNVKWRAL 59

Query: 202 RLDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATPFKQWYQKHYN 381
           RLDTGNYSWGSEAVTRK RILDVVYNASNNELVRTQTLVK+AIVQVDA PFKQWY  HY 
Sbjct: 60  RLDTGNYSWGSEAVTRKTRILDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLTHYG 119

Query: 382 VELGAKNQA-----------EIVPKPEEIKGSNHVKRKIKERLQKRKLDSHLAEQFSTGR 528
           V++G K +            E+    EE K SNHV RK+++R + R LD H+ EQF +GR
Sbjct: 120 VDIGRKKKTPAAKKDNAEGQEVEAAAEETKKSNHVTRKLEKRKEGRTLDPHIEEQFGSGR 179

Query: 529 LFACISSRPGQCGRCDGYILEGKELEFYVKKMQKKKSKAA 648
           L ACISSRPGQCGR DGYILEGKELEFY+KK+Q+KK K+A
Sbjct: 180 LLACISSRPGQCGRADGYILEGKELEFYMKKLQRKKGKSA 219

>ref|NP_200732.2| 40S ribosomal protein S8 (RPS8B) [Arabidopsis thaliana]
           gi|17367670|sp|Q9FIF3|RS8_ARATH 40S ribosomal protein S8
           gi|9759245|dbj|BAB09769.1| 40S ribosomal protein S8
           [Arabidopsis thaliana] gi|28416637|gb|AAO42849.1|
           At5g59240 [Arabidopsis thaliana]
          Length = 210

 Score =  267 bits (683), Expect = 1e-70
 Identities = 138/209 (66%), Positives = 165/209 (78%)
 Frame = +1

Query: 22  MGISRDSLHKRRATGGRKEALAQEEEV*DGPCAG*HQAEQPSVAVRTVRVRGGHTKFRAL 201
           MGISRDS+HKRRATGG+++   ++ +   G     +     +  VR +RVRGG+ K+RAL
Sbjct: 1   MGISRDSIHKRRATGGKQKMWRKKRKYELGRQPA-NTKLSSNKTVRRIRVRGGNVKWRAL 59

Query: 202 RLDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATPFKQWYQKHYN 381
           RLDTGN+SWGSEAVTRK RILDV YNASNNELVRTQTLVK+AIVQVDA PFKQ Y +HY 
Sbjct: 60  RLDTGNFSWGSEAVTRKTRILDVAYNASNNELVRTQTLVKSAIVQVDAAPFKQGYLQHYG 119

Query: 382 VELGAKNQAEIVPKPEEIKGSNHVKRKIKERLQKRKLDSHLAEQFSTGRLFACISSRPGQ 561
           V++G K + E V   EE+K SNHV+RK++ R + R LDSHL EQFS+GRL ACI+SRPGQ
Sbjct: 120 VDIGRKKKGEAV-TTEEVKKSNHVQRKLEMRQEGRALDSHLEEQFSSGRLLACIASRPGQ 178

Query: 562 CGRCDGYILEGKELEFYVKKMQKKKSKAA 648
           CGR DGYILEGKELEFY+KK+QKKK K A
Sbjct: 179 CGRADGYILEGKELEFYMKKLQKKKGKNA 207

>ref|NP_197529.1| 40S ribosomal protein S8 (RPS8A) [Arabidopsis thaliana]
           gi|15293007|gb|AAK93614.1| unknown protein [Arabidopsis
           thaliana] gi|15450474|gb|AAK96530.1| AT5g20290/F5O24_180
           [Arabidopsis thaliana] gi|16974465|gb|AAL31236.1|
           AT5g20290/F5O24_180 [Arabidopsis thaliana]
           gi|20258879|gb|AAM14111.1| unknown protein [Arabidopsis
           thaliana] gi|21592577|gb|AAM64526.1| 40S ribosomal
           protein S8-like [Arabidopsis thaliana]
          Length = 222

 Score =  267 bits (683), Expect = 1e-70
 Identities = 138/222 (62%), Positives = 164/222 (73%), Gaps = 13/222 (5%)
 Frame = +1

Query: 22  MGISRDSLHKRRATGGRKEALAQEEEV*DGPCAG*HQAEQPSVAVRTVRVRGGHTKFRAL 201
           MGISRDS+HKRRATGG+++   ++ +   G     +     +  VR +RVRGG+ K+RAL
Sbjct: 1   MGISRDSIHKRRATGGKQKQWRKKRKYEMGRQPA-NTKLSSNKTVRRIRVRGGNVKWRAL 59

Query: 202 RLDTGNYSWGSEAVTRKVRILDVVYNASNNELVRTQTLVKNAIVQVDATPFKQWYQKHYN 381
           RLDTGNYSWGSEA TRK R+LDVVYNASNNELVRT+TLVK+AIVQVDA PFKQWY  HY 
Sbjct: 60  RLDTGNYSWGSEATTRKTRVLDVVYNASNNELVRTKTLVKSAIVQVDAAPFKQWYLSHYG 119

Query: 382 VELGAKNQA-------------EIVPKPEEIKGSNHVKRKIKERLQKRKLDSHLAEQFST 522
           VELG K ++               V  PEE+K SNH+ RKI  R + R LDSH+ +QF++
Sbjct: 120 VELGRKKKSASSTKKDGEEGEEAAVAAPEEVKKSNHLLRKIASRQEGRSLDSHIEDQFAS 179

Query: 523 GRLFACISSRPGQCGRCDGYILEGKELEFYVKKMQKKKSKAA 648
           GRL ACISSRPGQCGR DGYILEGKELEFY+KK+QKKK K A
Sbjct: 180 GRLLACISSRPGQCGRADGYILEGKELEFYMKKIQKKKGKGA 221



EST assemble image


clone accession position
1 LC064a01_r AV623451 1 631
2 MX229b03_r BP090786 6 445
3 LCL027g02_r AV627503 96 635
4 HCL056g10_r AV642728 96 651
5 CM054c02_r AV389969 101 446
6 LC052c04_r AV622635 102 602
7 MXL043f06_r BP095547 105 604
8 HC008e05_r AV632459 105 691
9 MX063a04_r BP088547 105 514
10 MXL022e09_r BP094400 105 519
11 CM066e05_r AV390870 105 736
12 MX001h03_r BP086098 106 634
13 CS001d06_r AV397986 106 673
14 HCL023a11_r AV640829 107 686
15 HC054g06_r AV636066 107 575
16 HC021c03_r AV633474 108 639
17 MXL019d11_r BP094198 108 643
18 MXL077d07_r BP097534 108 470
19 CM034d06_r AV388637 108 439
20 MXL016c01_r BP093956 108 407
21 LCL039d05_r AV628269 108 600
22 CM061c09_r AV390589 108 755
23 MXL098d02_r BP098743 110 538
24 MX104d12_r BP089071 110 643
25 MX102h05_r BP088936 110 377
26 MX251f09_r BP092254 111 645
27 CM059c11_r AV390714 111 757
28 MX258e11_r BP092747 111 704
29 MXL001a12_r BP092937 111 644
30 HCL066h07_r AV643279 111 662
31 HCL042d07_r AV641916 111 635
32 MX002f01_r BP086137 112 576
33 HCL036b12_r AV641555 112 682
34 MX207b12_r BP089433 112 655
35 MXL069b07_r BP097044 112 638
36 HC004f10_r AV632160 113 516
37 HC018g10_r AV633272 115 662
38 MX051d01_r BP088092 115 286
39 MXL011d03_r BP093641 115 589
40 MXL056c12_r BP096306 115 564
41 HC077b10_r AV637762 115 691
42 HC044c08_r AV635278 115 626
43 HCL008d10_r AV639993 115 621
44 CL26g04_r AV394583 116 561
45 HCL043b08_r AV641964 116 635
46 MX260d06_r BP092883 116 661
47 HCL034b07_r AV641468 116 682
48 MX043c03_r BP087768 116 506
49 CS001b04_r AV397937 116 689
50 MXL093f01_r BP098453 116 523
51 CL65e05_r AV396562 116 692
52 HC039g06_r AV634928 116 697
53 HCL067h11_r AV643343 116 576
54 HC033f07_r AV634459 116 626
55 MXL017c01_r BP094032 116 635
56 HCL085h11_r AV644305 118 640
57 MX242f03_r BP091681 118 697
58 CL21h08_r AV394402 118 695
59 MXL019d05_r BP094193 118 653
60 HC073a10_r AV637430 119 710
61 MX250a05_r BP092120 120 641
62 CL71a09_r AV396904 170 809
63 CL62c01_r AV396427 176 784
64 MXL076b10_r BP097467 187 601
65 MXL084b08_r BP097960 187 597
66 CL66h02_r AV396729 204 809
67 CL01g08_r AV393331 259 782
68 CL40d09_r AV395348 265 780
69 CL13a12_r AV393905 275 759
70 CL70e12_r AV396841 283 855
71 LC079g06_r AV624586 292 829
72 CL12e01_r AV393828 301 818
73 CL14h04_r AV393859 303 864
74 CL47f10_r AV395698 312 863
75 MX034h04_r BP087454 320 731
76 CL61b02_r AV396317 321 869
77 CL18d09_r AV394063 326 876
78 CL51h08_r AV395938 352 869
79 CL03f08_r AV393429 358 874
80 CL27c11_r AV394696 367 875
81 LC036a01_r AV621427 412 912
82 LCL087d06_r AV630997 506 868
83 LCL043a04_r AV628509 597 869




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research