KCC000029A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000029A_C01 KCC000029A_c01
ACAAAAAAGGTCGGCATCGTCGGCAAGTACGGTACTCGCTATGGTGCGAGTCTCCGTAAG
GTGATCAAGAAGATGGAGGTCAGCCAGCACTCCAAGTACTTCTGCCACTTCTGCGGCAAG
TTCGCCATGAAGCGCCAGGCGGTGGGCATCTGGGGCTGCAAGGCGTGCAACAAGGTGCAG
GCCGGCGGTGCTTACACCCTGAACACCGCCTCGTCGGTGACCGTCCGCTCCACGATCCGC
CGTCTTCGTGAGCAGGTGGAGGCATAAATGCCTCTCAACCTGTGCTGTGTAACGTGTTGC
GGGTTTAAAAAAAAAAAAAAAAAAAACAAAAAACATAAAAAAAAAAAAAAT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000029A_C01 KCC000029A_c01
         (351 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|Q9XHE4|R37A_GOSHI 60S RIBOSOMAL PROTEIN L37A gi|4741896|gb|AA...   162  9e-40
dbj|BAB90039.1| putative 60S ribosomal protein L37a [Oryza sativ...   162  1e-39
ref|NP_567096.1| 60S ribosomal protein L37a (RPL37aC) [Arabidops...   159  7e-39
sp|Q9ZRS8|R37A_PSEMZ 60S ribosomal protein L37a gi|4090257|emb|C...   157  3e-38
sp|P43209|R37A_BRARA 60S RIBOSOMAL PROTEIN L37A gi|421866|pir||S...   155  2e-37

>sp|Q9XHE4|R37A_GOSHI 60S RIBOSOMAL PROTEIN L37A gi|4741896|gb|AAD28753.1|AF127042_1 60S
           ribosomal protein L37a [Gossypium hirsutum]
          Length = 92

 Score =  162 bits (411), Expect = 9e-40
 Identities = 77/88 (87%), Positives = 83/88 (93%)
 Frame = +1

Query: 1   TKKVGIVGKYGTRYGASLRKVIKKMEVSQHSKYFCHFCGKFAMKRQAVGIWGCKACNKVQ 180
           TKK GIVGKYGTRYGASLRK IKKMEVSQHSKYFC FCGK+A+KR+AVGIWGCKAC KV+
Sbjct: 5   TKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKACGKVK 64

Query: 181 AGGAYTLNTASSVTVRSTIRRLREQVEA 264
           AGGAYTLNTAS+VTVRSTIRRLREQ E+
Sbjct: 65  AGGAYTLNTASAVTVRSTIRRLREQTES 92

>dbj|BAB90039.1| putative 60S ribosomal protein L37a [Oryza sativa (japonica
           cultivar-group)]
          Length = 122

 Score =  162 bits (409), Expect = 1e-39
 Identities = 77/88 (87%), Positives = 82/88 (92%)
 Frame = +1

Query: 1   TKKVGIVGKYGTRYGASLRKVIKKMEVSQHSKYFCHFCGKFAMKRQAVGIWGCKACNKVQ 180
           TKK GIVGKYGTRYGASLRK IKKMEVSQHSKYFC FCGKFA+KR+AVGIWGCK C KV+
Sbjct: 35  TKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKDCGKVK 94

Query: 181 AGGAYTLNTASSVTVRSTIRRLREQVEA 264
           AGGAYT+NTAS+VTVRSTIRRLREQ EA
Sbjct: 95  AGGAYTMNTASAVTVRSTIRRLREQTEA 122

>ref|NP_567096.1| 60S ribosomal protein L37a (RPL37aC) [Arabidopsis thaliana]
           gi|19347788|gb|AAL86345.1| unknown protein [Arabidopsis
           thaliana] gi|21436265|gb|AAM51271.1| unknown protein
           [Arabidopsis thaliana] gi|21593754|gb|AAM65721.1| 60S
           ribosomal protein L37a [Arabidopsis thaliana]
          Length = 92

 Score =  159 bits (403), Expect = 7e-39
 Identities = 74/87 (85%), Positives = 82/87 (94%)
 Frame = +1

Query: 1   TKKVGIVGKYGTRYGASLRKVIKKMEVSQHSKYFCHFCGKFAMKRQAVGIWGCKACNKVQ 180
           TKKVGIVGKYGTRYGAS+RK IKKMEVSQHSKYFC FCGK+ +KR+AVGIWGCK C KV+
Sbjct: 5   TKKVGIVGKYGTRYGASIRKQIKKMEVSQHSKYFCEFCGKYGVKRKAVGIWGCKDCGKVK 64

Query: 181 AGGAYTLNTASSVTVRSTIRRLREQVE 261
           AGGAYT+NTAS+VTVRSTIRRLREQ+E
Sbjct: 65  AGGAYTMNTASAVTVRSTIRRLREQIE 91

>sp|Q9ZRS8|R37A_PSEMZ 60S ribosomal protein L37a gi|4090257|emb|CAA10493.1| ribosomal
           protein L37A [Pseudotsuga menziesii]
          Length = 92

 Score =  157 bits (398), Expect = 3e-38
 Identities = 75/87 (86%), Positives = 80/87 (91%)
 Frame = +1

Query: 1   TKKVGIVGKYGTRYGASLRKVIKKMEVSQHSKYFCHFCGKFAMKRQAVGIWGCKACNKVQ 180
           TKK GIVGKYGTRYGASLRK IKKMEVSQHSK+FC FCGKFA+KR+AVGIWGCK C KV+
Sbjct: 5   TKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKFFCEFCGKFAVKRKAVGIWGCKDCGKVK 64

Query: 181 AGGAYTLNTASSVTVRSTIRRLREQVE 261
           AGGAYTLNT S+VTVRSTIRRLREQ E
Sbjct: 65  AGGAYTLNTPSAVTVRSTIRRLREQTE 91

>sp|P43209|R37A_BRARA 60S RIBOSOMAL PROTEIN L37A gi|421866|pir||S34661 ribosomal protein
           L37a, cytosolic - turnip gi|347062|gb|AAA51421.1|
           ribosomal protein gi|395077|emb|CAA80864.1| ribosomal
           protein L37a [Brassica rapa]
          Length = 93

 Score =  155 bits (391), Expect = 2e-37
 Identities = 74/88 (84%), Positives = 82/88 (93%), Gaps = 1/88 (1%)
 Frame = +1

Query: 1   TKKVGIVGKYGTRYGASLRKVIKKMEVSQHSKYFCHFCGKFAMKRQAVGIWGCKACNKVQ 180
           TKKVGIVGKYGTRYGAS+RK IKKMEVSQHSKYFC FCGK+ +KR+AVGIWGCK C KV+
Sbjct: 5   TKKVGIVGKYGTRYGASIRKQIKKMEVSQHSKYFCEFCGKYGVKRKAVGIWGCKDCGKVK 64

Query: 181 AGGAYTLNTASSVTVRS-TIRRLREQVE 261
           AGGAYT+NTAS+VTVRS TIRRLREQ+E
Sbjct: 65  AGGAYTMNTASAVTVRSHTIRRLREQIE 92



EST assemble image


clone accession position
1 HCL007h02_r AV639952 1 326
2 CL01g06_r AV393356 5 372
3 HCL095d05_r AV644907 12 328
4 HCL092g05_r AV644715 16 328
5 HCL100b08_r AV645245 18 328
6 HCL097c11_r AV645039 22 327
7 HCL092a06_r AV644672 22 185
8 HCL095c03_r AV644897 27 326
9 LCL041d01_r AV628410 31 327
10 HCL041g04_r AV641877 90 327




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research