KCC000028A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000028A_C01 KCC000028A_c01
TAAAGATGGCCGACCAGACTGAGAGGGCGTTCCAGAAGCAGTTCGGCGTGACCGGCTGCT
TCAAGTCCAAGGAGAAGAAGGCTCCGGGCAAGAGCGGCCACCGCTTCTACAAGCAGATTG
GCCTGGGCTTCAAGACCCCCAAGGAGGCTATCGAGGGCCACTACATCGACAAGAAGTGCC
CCTTCACCGGCAACGTGTCCATCCGTGGCCGTATCCTCACGGGCTACGTGAAGTCCACGA
AGATGAACCGCACCATCATCGTCCGCCGCGACTACCTGCACTTCGTGAAGAAGTACGGCC
GTTACGAGAAGCGCCACCGCAACATCTCGGCCCACATCTCCCCGTGCTTCCGCGTGCGCG
AGGGTGACTCCGTGGTCATTGGCCAGTGCCGCCCCCTGTCCAAGACCGTCCGCTTCAACG
TGCTGCGTGTGACTCCCTCGGGCTCGTCGGCCAAGAAGGGCTTCTCGTCCTTCTAAACGC
CCGATTGGGATAGGAGTGTAACCTACGGTCTCAGGAAAAAAAAAAAAACATAAAACAAAA
AAACAAAACAAAAAACTGTGGGGGGCCGGTTCCCATCGCCCAAAGAAGTGATAACCGCCC
AGACGCTTTCACGATGGTGGGGAACCTGGTTCAAA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000028A_C01 KCC000028A_c01
         (635 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P42756|RS11_DUNTE 40S RIBOSOMAL PROTEIN S11 gi|7440474|pir||T...   270  2e-71
ref|NP_190462.1| 40S ribosomal protein S11 (RPS11A) [Arabidopsis...   224  6e-58
sp|P25460|RS11_MAIZE 40S RIBOSOMAL PROTEIN S11 gi|82722|pir||S16...   224  6e-58
sp|P17093|RS11_SOYBN 40S RIBOSOMAL PROTEIN S11 gi|454848|gb|AAC1...   224  6e-58
gb|AAA32866.1| ribosomal protein S11 (probable start codon at bp...   224  6e-58

>sp|P42756|RS11_DUNTE 40S RIBOSOMAL PROTEIN S11 gi|7440474|pir||T10730 ribosomal protein
           S11 - green alga (Dunaliella tertiolecta)
           gi|534959|emb|CAA46835.1| ribosomal protein S11
           [Dunaliella tertiolecta]
          Length = 157

 Score =  270 bits (689), Expect = 2e-71
 Identities = 126/157 (80%), Positives = 143/157 (90%), Gaps = 1/157 (0%)
 Frame = +3

Query: 6   MADQTERAFQKQFGVTGCFKSKEKKAPGKSGHRFYKQIGLGFKTPKEAIEGHYIDKKCPF 185
           MA+QTE+AFQKQ GVTGCFKSKEKKAPGKSGHRF+K +GL FKTPKEAI+G+Y+DKKCPF
Sbjct: 1   MAEQTEKAFQKQVGVTGCFKSKEKKAPGKSGHRFFKNVGLNFKTPKEAIDGNYVDKKCPF 60

Query: 186 TGNVSIRGRILTGYVKSTKMNRTIIVRRDYLHFVKKYGRYEKRHRNISAHISPCFRVREG 365
           TGNVSIRGRILTG VKS+KM RTIIVRRDYLHF+ KY RYEKRH NI AH+SPCFRVR+G
Sbjct: 61  TGNVSIRGRILTGVVKSSKMMRTIIVRRDYLHFIPKYARYEKRHTNIPAHVSPCFRVRDG 120

Query: 366 DSVVIGQCRPLSKTVRFNVLRVTP-SGSSAKKGFSSF 473
           D+V+IGQCRPLSKT+RFNVLRV P +G++ KK FS F
Sbjct: 121 DTVIIGQCRPLSKTIRFNVLRVIPQAGATGKKSFSGF 157

>ref|NP_190462.1| 40S ribosomal protein S11 (RPS11A) [Arabidopsis thaliana]
           gi|133866|sp|P16181|R11A_ARATH 40S ribosomal protein
           S11-1 gi|81659|pir||C35542 ribosomal protein S11 -
           Arabidopsis thaliana gi|454808|gb|AAC14454.1| ribosomal
           protein S11 [Arabidopsis thaliana]
           gi|6522573|emb|CAB62017.1| cytosolic ribosomal protein
           S11 [Arabidopsis thaliana] gi|16649155|gb|AAL24429.1|
           cytosolic ribosomal protein S11 [Arabidopsis thaliana]
           gi|20148571|gb|AAM10176.1| cytosolic ribosomal protein
           S11 [Arabidopsis thaliana] gi|21593611|gb|AAM65578.1|
           cytosolic ribosomal protein S11 [Arabidopsis thaliana]
          Length = 160

 Score =  224 bits (572), Expect = 6e-58
 Identities = 111/157 (70%), Positives = 127/157 (80%), Gaps = 1/157 (0%)
 Frame = +3

Query: 6   MADQTERAFQKQFGV-TGCFKSKEKKAPGKSGHRFYKQIGLGFKTPKEAIEGHYIDKKCP 182
           MA+QTE+AF KQ  V     KS + K PGK G+RF+K IGLGFKTP+EAI+G Y+DKKCP
Sbjct: 1   MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYVDKKCP 60

Query: 183 FTGNVSIRGRILTGYVKSTKMNRTIIVRRDYLHFVKKYGRYEKRHRNISAHISPCFRVRE 362
           FTG VSIRGRIL G   S KM RTIIVRRDYLHFVKKY RYEKRH NI AH+SPCFRV+E
Sbjct: 61  FTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE 120

Query: 363 GDSVVIGQCRPLSKTVRFNVLRVTPSGSSAKKGFSSF 473
           GD ++IGQCRPLSKTVRFNVL+V P+GSS+  G  +F
Sbjct: 121 GDHIIIGQCRPLSKTVRFNVLKVIPAGSSSSFGKKAF 157

>sp|P25460|RS11_MAIZE 40S RIBOSOMAL PROTEIN S11 gi|82722|pir||S16577 ribosomal protein
           S11 - maize gi|22470|emb|CAA39438.1| ribosomal protein
           S11 [Zea mays]
          Length = 159

 Score =  224 bits (572), Expect = 6e-58
 Identities = 114/158 (72%), Positives = 130/158 (82%), Gaps = 3/158 (1%)
 Frame = +3

Query: 6   MADQTERAFQKQFGV-TGCFKSKEKKAPGKSGHRFYKQIGLGFKTPKEAIEGHYIDKKCP 182
           MA+QTE+AF KQ  V     KS + K PGK G+RF+K IGLGFKTP+EAIEG YIDKKCP
Sbjct: 1   MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP 60

Query: 183 FTGNVSIRGRILTGYVKSTKMNRTIIVRRDYLHFVKKYGRYEKRHRNISAHISPCFRVRE 362
           FTG VSIRGRI+ G   S KMNRTIIVRR+YLHFVKKY RYEKRH NI AHISPCFRV+E
Sbjct: 61  FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE 120

Query: 363 GDSVVIGQCRPLSKTVRFNVLRVTPSGSSA--KKGFSS 470
           GD V+IGQCRPLSKTVRFNV++V P+GS+A  KK F++
Sbjct: 121 GDHVIIGQCRPLSKTVRFNVVKVIPAGSAAAGKKAFTA 158

>sp|P17093|RS11_SOYBN 40S RIBOSOMAL PROTEIN S11 gi|454848|gb|AAC14469.1| ribosomal
           protein S11 [Glycine max]
          Length = 159

 Score =  224 bits (572), Expect = 6e-58
 Identities = 116/157 (73%), Positives = 128/157 (80%), Gaps = 3/157 (1%)
 Frame = +3

Query: 6   MADQTERAFQKQFGVTGCFKSKEK-KAPGKSGHRFYKQIGLGFKTPKEAIEGHYIDKKCP 182
           MA+QTE+AF KQ  V    K   K K PGK G+RF+K IGLGFKTP+EAIEG YIDKKCP
Sbjct: 1   MAEQTEKAFLKQPKVFLSTKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP 60

Query: 183 FTGNVSIRGRILTGYVKSTKMNRTIIVRRDYLHFVKKYGRYEKRHRNISAHISPCFRVRE 362
           FTGNVSIRGRIL G   S KMNRTIIVRR+YLHF+KKY RYEKRH NI AHISP FRV+E
Sbjct: 61  FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNIPAHISPAFRVKE 120

Query: 363 GDSVVIGQCRPLSKTVRFNVLRVTPSGSS--AKKGFS 467
           GD V+IGQCRPLSKTVRFNVL+V P+GSS  AKK F+
Sbjct: 121 GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSGAKKAFT 157

>gb|AAA32866.1| ribosomal protein S11 (probable start codon at bp 67)
          Length = 182

 Score =  224 bits (572), Expect = 6e-58
 Identities = 111/157 (70%), Positives = 127/157 (80%), Gaps = 1/157 (0%)
 Frame = +3

Query: 6   MADQTERAFQKQFGV-TGCFKSKEKKAPGKSGHRFYKQIGLGFKTPKEAIEGHYIDKKCP 182
           MA+QTE+AF KQ  V     KS + K PGK G+RF+K IGLGFKTP+EAI+G Y+DKKCP
Sbjct: 23  MAEQTEKAFLKQPKVFLSSKKSGKGKRPGKGGNRFWKNIGLGFKTPREAIDGAYVDKKCP 82

Query: 183 FTGNVSIRGRILTGYVKSTKMNRTIIVRRDYLHFVKKYGRYEKRHRNISAHISPCFRVRE 362
           FTG VSIRGRIL G   S KM RTIIVRRDYLHFVKKY RYEKRH NI AH+SPCFRV+E
Sbjct: 83  FTGTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE 142

Query: 363 GDSVVIGQCRPLSKTVRFNVLRVTPSGSSAKKGFSSF 473
           GD ++IGQCRPLSKTVRFNVL+V P+GSS+  G  +F
Sbjct: 143 GDHIIIGQCRPLSKTVRFNVLKVIPAGSSSSFGKKAF 179



EST assemble image


clone accession position
1 CL05f09_r AV393587 1 611
2 CL78a04_r AV397191 3 630
3 CL62c07_r AV396414 7 611
4 CL22e09_r AV394268 12 626
5 MX019d07_r BP086877 15 533
6 CL30h02_r AV394744 16 628
7 CL01f10_r AV393299 76 606
8 LCL046f03_r AV628753 82 619
9 LC066f09_r AV623642 83 523
10 CL16c05_r AV393995 83 641
11 CL23c03_r AV394472 83 594
12 HCL034g12_r AV641501 83 562
13 CL44g10_r AV395616 84 594
14 CL37h02_r AV395274 84 627
15 HC071h04_r AV637340 84 552
16 LC041d12_r AV621827 87 626
17 CL03f06_r AV393404 87 613
18 CL37f05_r AV395277 87 613
19 LC075c07_r AV624264 88 605
20 CL31e10_r AV394995 88 605
21 CM088c09_r AV393048 89 676
22 CL27c06_r AV394689 90 593
23 CL26c04_r AV394573 90 620
24 HCL091a08_r AV644594 90 498
25 MX229g05_r BP090832 90 501
26 HC033a02_r AV634406 90 607
27 HC028a01_r AV634001 90 633
28 MXL037c03_r BP095179 90 470
29 HC098g05_r AV639391 90 506
30 HC079e07_r AV637930 90 569
31 HC010g12_r AV632648 90 586
32 CL10c03_r AV393695 90 601
33 CL33d01_r AV394965 91 628
34 CL35h07_r AV395058 91 540
35 CL10c01_r AV393670 91 629
36 CL08g04_r AV393509 91 630
37 CL01g04_r AV393322 91 612
38 CL44g09_r AV395609 91 529
39 CL22h10_r AV394279 91 247
40 CL56h05_r AV396082 91 598
41 CL41f01_r AV395400 91 589
42 CL36h07_r AV395152 91 592
43 CL41g03_r AV395428 91 562
44 LC026f01_r AV620769 91 637
45 CL08a03_r AV393510 91 583
46 CM012d01_r AV387160 92 631
47 CL73f10_r AV396973 92 628
48 CL60e06_r AV396364 93 628
49 CL73a02_r AV396993 94 628
50 CL59h06_r AV397922 94 549
51 CL16b07_r AV394016 95 631
52 CL15e10_r AV393944 95 628
53 MX004b03_r BP086208 95 503
54 CL60h09_r AV396386 95 628
55 HCL011h03_r AV640188 95 561
56 MX256b12_r BP092577 95 611
57 CL41f09_r AV395409 95 599
58 CL39c08_r AV395202 95 578
59 CL41e08_r AV395421 97 589
60 CL70e08_r AV396828 97 631
61 LCL069d09_r AV629936 97 562
62 CL16e06_r AV394034 97 630
63 CL66g07_r AV396766 98 636
64 HC011c09_r AV632684 98 590
65 CL10d05_r AV393676 98 599
66 MX231b06_r BP090928 99 389
67 CM074e04_r AV391530 99 749
68 HC004g08_r AV632168 99 629
69 HCL100d11_r AV645270 99 451
70 CL79c02_r AV397170 99 628
71 CL03e05_r AV393415 99 629
72 CL54h01_r AV396173 99 575
73 MX031c03_r BP087302 99 563
74 CL39c10_r AV395197 99 593
75 CL61e11_r AV396328 100 612
76 CL35c03_r AV395098 100 559
77 MX103d05_r BP088978 100 581
78 CL36h06_r AV395122 100 613
79 MX101a07_r BP088785 100 503
80 CL53d02_r AV395955 100 612
81 CL38e12_r AV395332 100 626
82 CL70d08_r AV396827 100 629
83 CL73h02_r AV396999 100 639
84 CL37b05_r AV395254 101 627
85 CL41c09_r AV395406 101 625
86 CL36g08_r AV395151 101 611
87 CL68c09_r AV396925 101 629
88 CL32h02_r AV394874 101 551
89 CL02f10_r AV397605 101 629
90 MX250a01_r BP092116 101 630
91 CL40f10_r AV395357 102 611
92 CL24h05_r AV394416 104 601
93 CL70d06_r AV396849 104 629
94 MX249d07_r BP092073 105 629
95 CL64b02_r AV396652 105 630
96 CL01g02_r AV393355 107 679
97 CL23g07_r AV394480 108 613
98 CL09c03_r AV393733 109 626
99 CL09d09_r AV393718 109 631
100 CL26b09_r AV394611 109 629
101 CL74h04_r AV396480 110 629
102 CL65b09_r AV396563 110 616
103 CL12h03_r AV393807 110 634
104 CL17g08_r AV394127 112 612
105 CM071d10_r AV391367 112 738
106 CL73e12_r AV396991 121 628
107 CL23d05_r AV394503 122 629
108 CL27f05_r AV394706 128 600
109 CL24a05_r AV394407 130 558
110 CM034h08_r AV388669 144 721
111 CL08a01_r AV393495 164 686
112 CM095a12_r AV392712 175 630
113 CL60a11_r AV396366 183 628
114 CL58h12_r AV396185 197 626
115 CL29b11_r AV394658 296 624




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research