KCC000027A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000027A_C01 KCC000027A_c01
GCTAGTCGACCATTTCTCCTTTGCACACCACAGCAGCAAAGATGGCCCTCCGCGCTGCCC
AGTCCGCTAAGGCCGGTGTCCGTGCCGCCCGGCCCAACCGTGCCACCGCCGCTGGTGTGC
AAGGCGCAGAAGGTCGGCCAGGCCGCCGCTGCCGCTGCTCTGGCCACCGCCATGGTTGCC
GGGTCGGCCAACGCCCTGACCTTCGACGAGATTCAGGGCCTGACCTACCTGCAGGTCAAG
GGCTCCGGCATTTGCCCAACACCTGCCCCGTGCTGGAGAGCGGCACCACCAACCTGAAGG
AGCTGAAGGGCCGGCTCCTACAAGCTGGAGAACTTCTGCATTGAGCCCACCTCTTTCACC
GTGAAGGAGGAGAGCCAGTTCAAGGGTGGCGAGACTGAGTTTGTCAAGACCAAGCTCATG
ACCCGCCTGACCTACACCCTGGACGCCATGTCCGGCTCGTTCAAGGTCGGCTCTGACGGC
TCCGCTGAGCTGAAGGAGGATGACGGCATTGACTACGCCGCCACCACGCGTCCAGCTGCC
CGGTGGCGAGCGCGTGGCTTTCCTGTTCACCATCAAGCAGTTCGATGGCAAGGGCACCCT
GGACAACATCAAGGGTGACTTCCTGGTGCCCTCGTACCGCGGCTCGTCCTTCCTGGACCC
CAAGGGCCGCGGTGGCTCGACCGGCTACGACAACGCCGTGGCTCTGCCCGCCCGCGCTGA
TGCCGAGGAGCTGCTGAAGGAGAACGTGAAGATCACCAAGGCCCTGAAGGGCTCTGCCGT
GTTCTCCGTTGCCAAGGTGGACCCCGTGACCGGCGAGATCGCTGGTGTGTTCGAGTCCAT
CCAGCCCTCGGACACTGACCTGGGCGCCAAGCCCCCCAAGGGACATCAAGGTCACCGGCC
TGTGGTACGCCCAGCTGAAGTAAGCGCTTTCGCCCCCCGAAGATAAACACTTCTGGAGGA
GGAGGACGCTACTGCTTAGCATGGTCGACCGCTGCGAGGAGGAGACGTGAGCCAGGATGC
TGGAGGAGCTCTAGCGGGTGTACATCGTAGGTGCTGCTTCCGGGATTGGAAGGGTAGGCA
AAGCAGTGCTGCGGGCGGGCAGACGGCGTGTCAAAACGCTCGCCTGTGTGCGGTGCAGTG
CTGGAGCGTTTTTGTTGAGGACGCTCAAACTCGGGTGGATTCAGAGGTCGGGGCGCGGAG
GTTGCGTGGTTGATCGAGCGGGGGCCAAACGTTGCCGCTGCCGCACGCCTGCCGTATGCG
CGCCCGGCAACAGCCGTGGTGCTGTCGGAGCGCGAGTGCCGGTTTTGGAGGTCTAGGAGT
GCTAGGTTGGTGCGAGCGCCGTGTCATCCGGCTTTTCGAGAAGAAAGATACAGTGTGCCC
AAAAGTGTGTGATTATTGTGTTTCATAGTGGCTCTCGAAACAAGGCCGCTTTCCCAGTGT
AGCCTGACACTTCGGAGCCCTATTTCCCCGACTCGCTTCTCGTCGTGCATGCGCTTTGCT
GGCAGTAGTGGCAGCACCGCTGCTCTCAGTCAATAACAGGCTGGCCAAAGGCCCCTGTGC
ACAGATTAGTCATGAGGCGTGTTTGCGGCCGGCGTGTAACACCCAAGATGAGAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAnannnnnnnnnnn
nannnnnnnnnnnnnnnnnnnnnnnnnaanaaaaa


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000027A_C01 KCC000027A_c01
         (1715 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P12853|PSBO_CHLRE Oxygen-evolving enhancer protein 1, chlorop...   231  e-126
sp|Q9SBN6|PSBO_VOLCA Oxygen-evolving enhancer protein 1, chlorop...   223  e-114
gb|AAP79149.1| photosystem II protein PsbO [Bigelowiella natans]      157  3e-73
sp|P26320|PSBO_SOLTU Oxygen-evolving enhancer protein 1, chlorop...   167  3e-70
pir||S16586 photosystem II oxygen-evolving complex protein 1 - p...   167  3e-70

>sp|P12853|PSBO_CHLRE Oxygen-evolving enhancer protein 1, chloroplast precursor (OEE1)
           gi|81252|pir||S05508 photosystem II oxygen-evolving
           complex protein 1 precursor - Chlamydomonas reinhardtii
           gi|18160|emb|CAA32053.1| OEE1 precursor protein
           [Chlamydomonas reinhardtii] gi|228625|prf||1807335A
           photosystem II OEE1 protein
          Length = 291

 Score =  231 bits (588), Expect(3) = e-126
 Identities = 116/117 (99%), Positives = 116/117 (99%)
 Frame = +2

Query: 530 VQLPGGERVAFLFTIKQFDGKGTLDNIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALP 709
           VQLPGGERVAFLFTIKQFDGKGTLD IKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALP
Sbjct: 162 VQLPGGERVAFLFTIKQFDGKGTLDGIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALP 221

Query: 710 ARADAEELLKENVKITKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPK 880
           ARADAEELLKENVKITKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPK
Sbjct: 222 ARADAEELLKENVKITKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPK 278

 Score =  229 bits (585), Expect(3) = e-126
 Identities = 122/145 (84%), Positives = 126/145 (86%)
 Frame = +1

Query: 94  PTVPPPLVCKAQKVGQAAAAAALATAMVAGSANALTFDEIQGLTYLQVKGSGICPTPAPC 273
           P     +VCKAQKVGQAAAAAALATAMVAGSANALTFDEIQGLTYLQVKGSGI  T  P 
Sbjct: 18  PNRATAVVCKAQKVGQAAAAAALATAMVAGSANALTFDEIQGLTYLQVKGSGIANT-CPV 76

Query: 274 WRAAPPT*RS*RAGSYKLENFCIEPTSFTVKEESQFKGGETEFVKTKLMTRLTYTLDAMS 453
             +     +  +AGSYKLENFCIEPTSFTVKEESQFKGGETEFVKTKLMTRLTYTLDAMS
Sbjct: 77  LESGTTNLKELKAGSYKLENFCIEPTSFTVKEESQFKGGETEFVKTKLMTRLTYTLDAMS 136

Query: 454 GSFKVGSDGSAELKEDDGIDYAATT 528
           GSFKVGSDGSAELKEDDGIDYAATT
Sbjct: 137 GSFKVGSDGSAELKEDDGIDYAATT 161

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 47/93 (50%), Positives = 52/93 (55%), Gaps = 4/93 (4%)
 Frame = +3

Query: 42  MALRAAQSAKAGVRAARPNRATAAGVQGAEGRPGRRCRCSGHRHGCRVGQRPDLRRDSGP 221
           MALRAAQSAKAGVRAARPNRATA   +    + G+    +        G    L  D   
Sbjct: 1   MALRAAQSAKAGVRAARPNRATAVVCKAQ--KVGQAAAAAALATAMVAGSANALTFDEIQ 58

Query: 222 DLP----AGQGLRHLPNTCPVLESGTTNLKELK 308
            L      G G   + NTCPVLESGTTNLKELK
Sbjct: 59  GLTYLQVKGSG---IANTCPVLESGTTNLKELK 88

 Score = 37.7 bits (86), Expect(3) = e-126
 Identities = 15/16 (93%), Positives = 16/16 (99%)
 Frame = +3

Query: 873 PPRDIKVTGLWYAQLK 920
           PP+DIKVTGLWYAQLK
Sbjct: 276 PPKDIKVTGLWYAQLK 291

>sp|Q9SBN6|PSBO_VOLCA Oxygen-evolving enhancer protein 1, chloroplast precursor (OEE1)
           gi|5902584|gb|AAD55562.1|AF110780_1 oxygen-evolving
           enhancer protein 1 precursor [Volvox carteri f.
           nagariensis]
          Length = 293

 Score =  223 bits (568), Expect(3) = e-114
 Identities = 112/117 (95%), Positives = 114/117 (96%)
 Frame = +2

Query: 530 VQLPGGERVAFLFTIKQFDGKGTLDNIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALP 709
           VQLPGGERVAFLFTIKQFDGKGTLDNIKGDF+VPSYRGSSFLDPKGRGGSTGYDNAVALP
Sbjct: 163 VQLPGGERVAFLFTIKQFDGKGTLDNIKGDFVVPSYRGSSFLDPKGRGGSTGYDNAVALP 222

Query: 710 ARADAEELLKENVKITKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPK 880
           ARADAEELLKENVK TKALKGSAVFSVAKV+  TGEIAGVFESIQPSDTDLGAKPPK
Sbjct: 223 ARADAEELLKENVKSTKALKGSAVFSVAKVNTATGEIAGVFESIQPSDTDLGAKPPK 279

 Score =  201 bits (511), Expect(3) = e-114
 Identities = 108/141 (76%), Positives = 117/141 (82%), Gaps = 2/141 (1%)
 Frame = +1

Query: 112 LVCKAQKV--GQAAAAAALATAMVAGSANALTFDEIQGLTYLQVKGSGICPTPAPCWRAA 285
           +VCKAQKV  GQAAAA   A+A+VAGSANALT+DE+QGLTYLQVKG+GI  T  P     
Sbjct: 23  VVCKAQKVEFGQAAAAVVAASALVAGSANALTYDELQGLTYLQVKGTGIANT-CPVLEKG 81

Query: 286 PPT*RS*RAGSYKLENFCIEPTSFTVKEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFK 465
                   AG+YKLENFCIEPTSFTVKEES FKGGETEFVKTKLMTRLTYTLDAMSG+ K
Sbjct: 82  STDLSELSAGTYKLENFCIEPTSFTVKEESVFKGGETEFVKTKLMTRLTYTLDAMSGTLK 141

Query: 466 VGSDGSAELKEDDGIDYAATT 528
           VGSDGSAELKE+DGIDYAATT
Sbjct: 142 VGSDGSAELKEEDGIDYAATT 162

 Score = 33.9 bits (76), Expect(3) = e-114
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = +3

Query: 873 PPRDIKVTGLWYAQL 917
           PP+DIK+TGLWY QL
Sbjct: 277 PPKDIKITGLWYGQL 291

>gb|AAP79149.1| photosystem II protein PsbO [Bigelowiella natans]
          Length = 327

 Score =  157 bits (396), Expect(3) = 3e-73
 Identities = 79/122 (64%), Positives = 90/122 (73%), Gaps = 2/122 (1%)
 Frame = +2

Query: 521 PPRVQLPGGERVAFLFTIKQFDGKGTLDNIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAV 700
           P  VQLPGG RV FLFT+K+ D KG + +  GDF VPSYRGS+FLDPKGRG +TGYD AV
Sbjct: 192 PTTVQLPGGARVPFLFTVKELDAKGDVSSFSGDFAVPSYRGSTFLDPKGRGAATGYDTAV 251

Query: 701 ALPA--RADAEELLKENVKITKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKP 874
           A+PA    D + L KEN K  K L G A  S+AK D  TGE+AGVF+SIQPSDTDLGAK 
Sbjct: 252 AIPAGGAGDEDALGKENNKSIKPLAGKAQLSIAKYDAATGEVAGVFQSIQPSDTDLGAKV 311

Query: 875 PK 880
           PK
Sbjct: 312 PK 313

 Score =  133 bits (335), Expect(3) = 3e-73
 Identities = 72/134 (53%), Positives = 89/134 (65%)
 Frame = +1

Query: 127 QKVGQAAAAAALATAMVAGSANALTFDEIQGLTYLQVKGSGICPTPAPCWRAAPPT*RS* 306
           + +    AAA +++    G++NALTFDE QGL+Y  VKGSG+  T             S 
Sbjct: 63  KNIAAGLAAAGVSSIGFLGASNALTFDEFQGLSYTDVKGSGMANTCPILNSGTTDVKGSL 122

Query: 307 RAGSYKLENFCIEPTSFTVKEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDGSA 486
           +AG+YK + FCIEPTSF VKE+     G+ EF+  KLMTRLTYTLDAMSGS KVGS G+ 
Sbjct: 123 KAGTYKFDKFCIEPTSFQVKED--VGKGKKEFIDVKLMTRLTYTLDAMSGSMKVGSGGAI 180

Query: 487 ELKEDDGIDYAATT 528
           E KE+DGIDYA TT
Sbjct: 181 EFKEEDGIDYAPTT 194

 Score = 30.8 bits (68), Expect(3) = 3e-73
 Identities = 11/15 (73%), Positives = 14/15 (93%)
 Frame = +3

Query: 876 PRDIKVTGLWYAQLK 920
           P+DIK+ GLWYAQL+
Sbjct: 312 PKDIKIQGLWYAQLQ 326

>sp|P26320|PSBO_SOLTU Oxygen-evolving enhancer protein 1, chloroplast precursor (OEE1)
           (33 kDa subunit of oxygen evolving system of photosystem
           II) (OEC 33 kDa subunit) (33 kDa thylakoid membrane
           protein)
          Length = 333

 Score =  167 bits (422), Expect(3) = 3e-70
 Identities = 87/119 (73%), Positives = 93/119 (78%), Gaps = 2/119 (1%)
 Frame = +2

Query: 530 VQLPGGERVAFLFTIKQFDGKGTLDNIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALP 709
           VQLPGGERV FLFTIKQ    G  ++   DFLVPSYRGSSFLDPKGRGGSTGYDNAVALP
Sbjct: 201 VQLPGGERVPFLFTIKQLVASGKPESFSVDFLVPSYRGSSFLDPKGRGGSTGYDNAVALP 260

Query: 710 A--RADAEELLKENVKITKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPK 880
           A  R D EEL KENVK T +L G   F+V K +P TGE+ GVFESIQPSDTDLGAK PK
Sbjct: 261 AGGRGDEEELQKENVKNTASLTGKITFTVTKSNPQTGEVIGVFESIQPSDTDLGAKTPK 319

 Score =  114 bits (285), Expect(3) = 3e-70
 Identities = 74/150 (49%), Positives = 87/150 (57%), Gaps = 15/150 (10%)
 Frame = +1

Query: 124 AQKVGQAAAAA--ALAT-AMVAGSANA------LTFDEIQGLTYLQVKGSGI---CPT-- 261
           AQK   AA  A  ALAT A+V   ANA      LTFDEIQ  TY++VKG+G    CPT  
Sbjct: 59  AQKCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTID 118

Query: 262 -PAPCWRAAPPT*RS*RAGSYKLENFCIEPTSFTVKEESQFKGGETEFVKTKLMTRLTYT 438
                +   P        G Y  + FC+EPTSFTVK E   K    +F KTKLMTRLTYT
Sbjct: 119 GGVDSFAFKP--------GKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYT 170

Query: 439 LDAMSGSFKVGSDGSAELKEDDGIDYAATT 528
           LD + G F+V  DG+ + +E DGIDYAA T
Sbjct: 171 LDEIEGPFEVSPDGTVKFEEKDGIDYAAVT 200

 Score = 29.6 bits (65), Expect(3) = 3e-70
 Identities = 9/15 (60%), Positives = 14/15 (93%)
 Frame = +3

Query: 876 PRDIKVTGLWYAQLK 920
           P+D+K+ G+WYAQL+
Sbjct: 318 PKDVKIQGIWYAQLE 332

>pir||S16586 photosystem II oxygen-evolving complex protein 1 - potato
           gi|809113|emb|CAA35601.1| 33kDa precursor protein of
           oxygen-evolving complex [Solanum tuberosum]
          Length = 332

 Score =  167 bits (422), Expect(3) = 3e-70
 Identities = 87/119 (73%), Positives = 93/119 (78%), Gaps = 2/119 (1%)
 Frame = +2

Query: 530 VQLPGGERVAFLFTIKQFDGKGTLDNIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALP 709
           VQLPGGERV FLFTIKQ    G  ++   DFLVPSYRGSSFLDPKGRGGSTGYDNAVALP
Sbjct: 200 VQLPGGERVPFLFTIKQLVASGKPESFSVDFLVPSYRGSSFLDPKGRGGSTGYDNAVALP 259

Query: 710 A--RADAEELLKENVKITKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPK 880
           A  R D EEL KENVK T +L G   F+V K +P TGE+ GVFESIQPSDTDLGAK PK
Sbjct: 260 AGGRGDEEELQKENVKNTASLTGKITFTVTKSNPQTGEVIGVFESIQPSDTDLGAKTPK 318

 Score =  114 bits (285), Expect(3) = 3e-70
 Identities = 74/150 (49%), Positives = 87/150 (57%), Gaps = 15/150 (10%)
 Frame = +1

Query: 124 AQKVGQAAAAA--ALAT-AMVAGSANA------LTFDEIQGLTYLQVKGSGI---CPT-- 261
           AQK   AA  A  ALAT A+V   ANA      LTFDEIQ  TY++VKG+G    CPT  
Sbjct: 58  AQKCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTID 117

Query: 262 -PAPCWRAAPPT*RS*RAGSYKLENFCIEPTSFTVKEESQFKGGETEFVKTKLMTRLTYT 438
                +   P        G Y  + FC+EPTSFTVK E   K    +F KTKLMTRLTYT
Sbjct: 118 GGVDSFAFKP--------GKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYT 169

Query: 439 LDAMSGSFKVGSDGSAELKEDDGIDYAATT 528
           LD + G F+V  DG+ + +E DGIDYAA T
Sbjct: 170 LDEIEGPFEVSPDGTVKFEEKDGIDYAAVT 199

 Score = 29.6 bits (65), Expect(3) = 3e-70
 Identities = 9/15 (60%), Positives = 14/15 (93%)
 Frame = +3

Query: 876 PRDIKVTGLWYAQLK 920
           P+D+K+ G+WYAQL+
Sbjct: 317 PKDVKIQGIWYAQLE 331



EST assemble image


clone accession position
1 HC010g07_r AV632644 1 674
2 HC045d02_r AV635356 4 599
3 MX217d07_r BP090012 13 479
4 MXL080a07_r BP097707 53 593
5 CM014b02_r AV387386 101 737
6 CM009h03_r AV397642 101 762
7 CM047h08_r AV388601 101 296
8 CM053h08_r AV389907 101 397
9 MX228e05_r BP090747 104 544
10 LC056e01_r AV622912 106 688
11 HC084e01_r AV638291 107 622
12 MX056g02_r BP088299 107 470
13 CM067a02_r AV390928 107 798
14 CM088a08_r AV393078 107 664
15 CM060d04_r AV390759 107 767
16 CM071b08_r AV391377 107 787
17 CM034a06_r AV388632 107 514
18 CM064c06_r AV390965 107 787
19 HC080d02_r AV637992 108 688
20 HC004b02_r AV632113 108 666
21 HC016e02_r AV633077 108 632
22 MX209e09_r BP089551 108 471
23 CM013d12_r AV387089 108 299
24 HC041f03_r AV635078 109 538
25 LC011e07_r AV619666 109 734
26 LC074e03_r AV624213 109 645
27 CM084b04_r AV392597 111 686
28 CM041e10_r AV389407 112 407
29 CM089f02_r AV392222 112 501
30 HC044d12_r AV635292 114 481
31 MX016c08_r BP086767 114 596
32 MXL040b08_r BP095338 118 566
33 HC063d02_r AV636720 123 643
34 HC094g10_r AV639085 123 570
35 LC061b11_r AV623260 123 712
36 LC006d03_r AV619302 123 479
37 MX210f03_r BP089611 123 629
38 HC024b12_r AV633704 130 637
39 MX022f10_r BP087005 130 555
40 HC027f07_r AV633978 130 711
41 HC046f10_r AV635466 130 655
42 HC005a04_r AV632182 130 691
43 HC006h11_r AV632340 130 686
44 MX034g10_r BP087450 139 558
45 CM052d02_r AV390498 146 755
46 CM019e12_r AV387332 146 832
47 HC016a09_r AV633048 146 689
48 CM059f02_r AV390704 162 840
49 CM037c02_r AV388838 165 764
50 HC003f10_r AV632082 209 869
51 CM091d04_r AV397537 271 641
52 HC024a03_r AV633685 314 894
53 HC017d08_r AV633155 318 842
54 HC076d02_r AV637695 320 900
55 MX243g11_r BP091754 320 850
56 HC062h03_r AV636686 353 843
57 MX012d12_r BP086594 380 979
58 MX254b03_r BP092431 381 915
59 LCL081e09_r AV630613 428 810
60 MX218d10_r BP090076 464 811
61 CM075f08_r AV391619 493 1201
62 MX232g10_r BP091036 513 786
63 CM059g05_r AV390653 515 1133
64 HC068f08_r AV637098 531 1062
65 HC050g10_r AV635779 532 913
66 MX007d07_r BP086369 536 1014
67 HC012f07_r AV632793 553 1043
68 CM068g05_r AV391068 583 1216
69 CM051e12_r AV389866 594 1167
70 CM008a08_r AV386757 620 1196
71 MXL074d12_r BP097361 655 1044
72 CM060e02_r AV390795 688 1311
73 MX102f12_r BP088921 688 1019
74 CM020d02_r AV397467 688 1272
75 MX103a08_r BP088949 690 1099
76 MX102h04_r BP088935 690 1204
77 MX103h06_r BP089022 691 1173
78 MXL012g03_r BP093728 697 1134
79 HC032b11_r AV634343 698 1221
80 HC063a08_r AV636696 786 1222
81 HC039c05_r AV634885 891 1407
82 LCL038g12_r AV628235 919 1127
83 MXL089e10_r BP098219 939 1380
84 HC093h06_r AV639018 964 1368
85 MXL004h06_r BP093198 973 1308
86 MXL003g01_r BP093120 976 1384
87 CM027c05_r AV387588 1051 1681
88 HC088g03_r AV638629 1080 1510
89 HC035h08_r AV634640 1080 1544
90 CL32b10_r AV394844 1134 1674
91 HC063e07_r AV636735 1237 1642
92 LC093a03_r AV625465 1305 1689
93 CL01f08_r AV393353 1368 1904
94 CM042c04_r AV389231 1400 1734
95 HC069f06_r AV637165 1480 1801




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research