KCC000026A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000026A_C01 KCC000026A_c01
tacgatctgtcggcggccgtggacagcgcctctgccggtggccaccgcgccgacgacgct
catcgcggcagccaccatcaCCAGCAGCACGGCCAGAGCGGCAGCAGCTACGTGAAGATA
TTTATTGCATTGATTGTCTGGCGACAGTGCGTGGGAAGTAAGAACGTAAAAGGATTCATC
GTGATAGTAAAAGGGCGTGATACGTACACGTTCAGGCATACACAACCAAGTGCCTCGAGG
AGGGAGCACTGGATTCGTGCGGCGACGAGGCTTTTACAAGACAAGCACAAGCATACGCAC
ACACATGTGGCGGTTTCTTTTTCTACATGGATTTTGACGCAATGTGCACATAAGTACAGG
GTTACGCATGGAAAGGGTGCCAGAGCAGGGTGTATGTGTGTGTGGTCAAGTGTGTGGTTG
GTACGAACACCTGGAACACCCACACACCCCGCGTACTGGCCAGTAGTTGTCATAACAGCG
GTATGCTGATCCAGCATGAGAAGCATCCGCATCACCAATAAACGCACCTGACGGCTGAGC
AGCTAGCTAGCTTGCTGCTACAGCCCACGGCCACATTATTTGCACGCCCACGCCATCTTA
TCTGCCGCTTGCTACTGCCATTCGATGGCAGCCGGCATATGATTGATGGTGTGGCCCATT
CGGTATGTTAACACACACGCTATCAACACGTTATGCATGCGCTGGTATATCAGCGCTTTT
TTTAAAGGAATGCTTATTGGGAAAGTTGCTGAGCAACTACTATTGCCCGCGGTAGGGTGT
AACCTAGCACTTGCTGTCCCGGAGACTGACGTGATGTGGGTTGGGCGGCTGGCAACGGCT
AGCCCGCCCCACGAATCGTTGGGGTTGTTTGATTGCGGACTCAGAGCATAGAAGGAGTAT
GATGGGTTCGTGATGACACACCGTGTTTTGCTATTGACAACATGGCTGGGCGGCACGAGC
CAAGTGTGACACGTAAGCACATTGTGGG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000026A_C01 KCC000026A_c01
         (988 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAC87430.1| unnamed protein product [Homo sapiens]                 44  0.003
dbj|BAC05810.1| seven transmembrane helix receptor [Homo sapiens]      44  0.004
ref|NP_042981.1| Hypothetical protein [Human herpesvirus 6] gi|8...    40  0.061
gb|AAL55824.1|AF318317_1 unknown [Homo sapiens]                        40  0.061
dbj|BAC87611.1| unnamed protein product [Homo sapiens]                 40  0.080

>dbj|BAC87430.1| unnamed protein product [Homo sapiens]
          Length = 303

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 8/103 (7%)
 Frame = -3

Query: 485 HTAVMTTTGQYAGCVGVPGVRTNHTLDHTHIHPALAPFPCVTLYLCAH-------CVKIH 327
           HT + T T  Y  C+       +HT  HTH++  +    C+ +Y+C +       CV + 
Sbjct: 22  HTYIYTYTCMYV-CI------YSHTYIHTHVYVCVHIHICIHMYMCVYTHIYACTCVCVC 74

Query: 326 VEKETATCVCVCLCLSCKSLVAARIQCSLLE-ALGCVCLNVYV 201
           V   T TC+CVC+       +   +   +      CVC + Y+
Sbjct: 75  VHTHTYTCICVCVHTHIYIHMCVCVYTRIYTYTCVCVCTHAYI 117

 Score = 40.0 bits (92), Expect = 0.061
 Identities = 25/104 (24%), Positives = 44/104 (42%), Gaps = 11/104 (10%)
 Frame = -3

Query: 404 HTHIHPALAPFPCVTLYLCAHC-VKIHVEKETATCVCVCL----------CLSCKSLVAA 258
           HTHI+  +    C   Y+  H  V ++    T TC+CVC+          C+   + +  
Sbjct: 190 HTHIYIHMYVCVCTHAYIHTHVYVCVYTRIYTYTCMCVCVYTRIYTYTYVCVCTHAYIHT 249

Query: 257 RIQCSLLEALGCVCLNVYVSRPFTITMNPFTFLLPTHCRQTINA 126
           ++         CVC + Y+     + +  +T++    CR TI A
Sbjct: 250 QVYV-------CVCTHAYIHTHVCVCVYTYTYMYTLWCRGTIIA 286

>dbj|BAC05810.1| seven transmembrane helix receptor [Homo sapiens]
          Length = 346

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 23/62 (37%), Positives = 31/62 (49%), Gaps = 3/62 (4%)
 Frame = -3

Query: 368 CVTLYLCAHCVKIHVEKETATCVCVCLCLS---CKSLVAARIQCSLLEALGCVCLNVYVS 198
           C  L LC  C+++ V      CVCVCLC+S   C S       C  +    CVC++V +S
Sbjct: 136 CACLSLCV-CIRVSVCLSLRVCVCVCLCVSVYVCVSSYLCVYLCVCMYVCECVCVSVSLS 194

Query: 197 RP 192
            P
Sbjct: 195 DP 196

 Score = 37.0 bits (84), Expect = 0.52
 Identities = 21/67 (31%), Positives = 31/67 (45%), Gaps = 6/67 (8%)
 Frame = -3

Query: 383 LAPFPCVTLYLCAH---CVKIHVEKETATCVCVCLCLS---CKSLVAARIQCSLLEALGC 222
           L  F CV +Y+      CV +H+       VC+C+C+S   C S+ A    C  +    C
Sbjct: 91  LCVFLCVCVYVSVSVCLCVYLHISVYLCVYVCICVCVSVSLCVSVCACLSLCVCIRVSVC 150

Query: 221 VCLNVYV 201
           + L V V
Sbjct: 151 LSLRVCV 157

 Score = 36.2 bits (82), Expect = 0.89
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 14/71 (19%)
 Frame = -3

Query: 368 CVTLYLCAH-CVKIHVEKETATCVCVCLCLS-------------CKSLVAARIQCSLLEA 231
           C+ LY+C   CV + V    + CVC+C+C+S             C S+  +   C  L  
Sbjct: 16  CLYLYVCVCICVSVCVCICVSVCVCICVCVSVFVCVCICVCVCVCVSMCVSISVCVYLCL 75

Query: 230 LGCVCLNVYVS 198
             CV + VYVS
Sbjct: 76  CVCVSVCVYVS 86

>ref|NP_042981.1| Hypothetical protein [Human herpesvirus 6]
           gi|854065|emb|CAA58337.1| U88 [Human herpesvirus 6]
          Length = 413

 Score = 40.0 bits (92), Expect = 0.061
 Identities = 21/57 (36%), Positives = 30/57 (51%)
 Frame = -3

Query: 368 CVTLYLCAHCVKIHVEKETATCVCVCLCLSCKSLVAARIQCSLLEALGCVCLNVYVS 198
           CV L +C  CV + V      CVCVC+CL C SL      C  +    C+C+++ +S
Sbjct: 278 CVCLCVCL-CVCLCV------CVCVCVCLLCMSLCMCMCMCMCMCMCMCMCMSLCMS 327

 Score = 35.0 bits (79), Expect = 2.0
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 2/56 (3%)
 Frame = -3

Query: 368 CVTLYLCAH-CVKIHVEKETATCVCVCLCLS-CKSLVAARIQCSLLEALGCVCLNV 207
           CV L +C   CV + V      CVCVC+CL  C  L      C  +    CVCL V
Sbjct: 228 CVCLCVCVCVCVCVCVCVCVCVCVCVCVCLCVCVCLCVCLCVCLCVCVCVCVCLCV 283

 Score = 35.0 bits (79), Expect = 2.0
 Identities = 17/55 (30%), Positives = 25/55 (44%), Gaps = 3/55 (5%)
 Frame = -3

Query: 368 CVTLYLCAHCVKIHVEKETATCVCVCLCL---SCKSLVAARIQCSLLEALGCVCL 213
           CV   +C  C ++        CVCVC CL   +C  + A    C+ L    C+C+
Sbjct: 100 CVCARVCV-CARVCARVCVCACVCVCACLCVCACLCVCACLCVCACLCVCACLCV 153

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 22/58 (37%), Positives = 28/58 (47%), Gaps = 2/58 (3%)
 Frame = -3

Query: 368 CVTLYLCAH-CVKIHVEKETATCVCVCLCL-SCKSLVAARIQCSLLEALGCVCLNVYV 201
           C  L +CA  CV   +      CVC CLC+ +C  + A    C+ L    CVCL V V
Sbjct: 124 CACLCVCACLCVCACLCVCACLCVCACLCVCACLCVCACLCVCACLCVCVCVCLCVCV 181

 Score = 33.9 bits (76), Expect = 4.4
 Identities = 22/58 (37%), Positives = 27/58 (45%), Gaps = 2/58 (3%)
 Frame = -3

Query: 368 CVTLYLCAH-CVKIHVEKETATCVCVCLCLS-CKSLVAARIQCSLLEALGCVCLNVYV 201
           C  L +CA  CV + V      C+CVC+CL  C  L      C  +    CVCL V V
Sbjct: 160 CACLCVCACLCVCVCVCLCVCVCLCVCVCLCVCVCLCVCVCLCVCVCLCVCVCLCVCV 217

 Score = 33.1 bits (74), Expect = 7.5
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%)
 Frame = -3

Query: 368 CVTLYLCAHCVKIHVEKETATCVCVCLCLS-CKSLVAARIQCSLLEALGCVCLNVYV 201
           CV L +C  C+ + V      C+CVC+CL  C  L      C  +    CVC+ V V
Sbjct: 192 CVCLCVCV-CLCVCVCLCVCVCLCVCVCLCVCVCLCVCVCLCVCVCVCVCVCVCVCV 247

 Score = 32.7 bits (73), Expect = 9.8
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 2/58 (3%)
 Frame = -3

Query: 368 CVTLYLCAH-CVKIHVEKETATCVCVCLCLS-CKSLVAARIQCSLLEALGCVCLNVYV 201
           CV L +C   CV + +      CVCVCLC+  C  +      C  +    CVCL V V
Sbjct: 204 CVCLCVCVCLCVCVCLCVCVCLCVCVCLCVCVCVCVCVCVCVCVCVCVCVCVCLCVCV 261

>gb|AAL55824.1|AF318317_1 unknown [Homo sapiens]
          Length = 400

 Score = 40.0 bits (92), Expect = 0.061
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 3/59 (5%)
 Frame = -3

Query: 368 CVTLYLCAHCVKIHVEKETATCVCVCLCLSCKSLVAARIQ---CSLLEALGCVCLNVYV 201
           C+ +Y+C  CV +HV       VC+C+C+     V A +    C  +    C+C+++YV
Sbjct: 27  CMCVYVCV-CVHVHVCASVCAFVCMCVCVCVCGSVCAFVSVHVCMRVYVCVCICVHLYV 84

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 7/64 (10%)
 Frame = -3

Query: 368 CVTLYLCAHCVKIHVEKETATCVCVCLCLSCKSLVAARI-------QCSLLEALGCVCLN 210
           C+ +Y+C  C+ +H+      CVC+C C+     +  R+        C+ + A  C+C+ 
Sbjct: 69  CMRVYVCV-CICVHLY--VCVCVCLCACVYACVCMCLRLCVRLCVSVCACVYACICMCIC 125

Query: 209 VYVS 198
           V+VS
Sbjct: 126 VHVS 129

 Score = 32.7 bits (73), Expect = 9.8
 Identities = 15/58 (25%), Positives = 30/58 (50%), Gaps = 2/58 (3%)
 Frame = -3

Query: 368 CVTLYLCAH-CVKIHVEKETATCVCVCLCLSCKSLVAARIQ-CSLLEALGCVCLNVYV 201
           CV + +C H C+++   +    C+CV +C+  +  V A +  C  +    CV + V++
Sbjct: 141 CVCVCVCVHVCMRVCAHQCLHVCICVYVCVCARICVCACVYVCVCISVCACVYVCVHL 198

 Score = 32.7 bits (73), Expect = 9.8
 Identities = 16/54 (29%), Positives = 24/54 (43%), Gaps = 3/54 (5%)
 Frame = -3

Query: 368 CVTLYLCAH---CVKIHVEKETATCVCVCLCLSCKSLVAARIQCSLLEALGCVC 216
           C  +Y+C H   C  +H       CVCVC C+       A +  +L+    C+C
Sbjct: 189 CACVYVCVHLCVCACVHA------CVCVCACVHLCVCACAHVGATLV----CIC 232

>dbj|BAC87611.1| unnamed protein product [Homo sapiens]
          Length = 201

 Score = 39.7 bits (91), Expect = 0.080
 Identities = 19/52 (36%), Positives = 25/52 (47%)
 Frame = -3

Query: 368 CVTLYLCAHCVKIHVEKETATCVCVCLCLSCKSLVAARIQCSLLEALGCVCL 213
           CV + +C  CV + V      CVCVC+CL    L  +   C  +    CVCL
Sbjct: 13  CVCVCVCVLCVSVCVCVCLCVCVCVCVCLCLCVLSVSVCLCVCVSVCLCVCL 64

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 19/56 (33%), Positives = 26/56 (45%)
 Frame = -3

Query: 368 CVTLYLCAHCVKIHVEKETATCVCVCLCLSCKSLVAARIQCSLLEALGCVCLNVYV 201
           CV L LC   V + +      CV VCLC+   S+      C  +    CVCL++ V
Sbjct: 38  CVCLCLCVLSVSVCL----CVCVSVCLCVCLVSVCLCVCLCVCVSVCLCVCLHLCV 89

 Score = 33.5 bits (75), Expect = 5.8
 Identities = 14/37 (37%), Positives = 19/37 (50%)
 Frame = -3

Query: 317 ETATCVCVCLCLSCKSLVAARIQCSLLEALGCVCLNV 207
           E   CVCVC+C+ C S+      C  +    C+CL V
Sbjct: 9   EGCVCVCVCVCVLCVSVCVCVCLCVCVCVCVCLCLCV 45

 Score = 32.7 bits (73), Expect = 9.8
 Identities = 14/30 (46%), Positives = 18/30 (59%), Gaps = 1/30 (3%)
 Frame = -3

Query: 368 CVTLYLCAH-CVKIHVEKETATCVCVCLCL 282
           CV L LC   CV + V    + CVCVC+C+
Sbjct: 158 CVCLCLCVFLCVCVFVSVCVSVCVCVCMCI 187



EST assemble image


clone accession position
1 LC031g10_r AV621143 1 514
2 HC055e03_r AV636125 225 659
3 CM060g08_r AV390768 296 800
4 CM009h10_r AV397668 378 945
5 CL01f07_r AV393327 492 981
6 HCL094f05_r AV644848 738 995




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research