KCC000025A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000025A_C02 KCC000025A_c02
ATGGAGGCGTCGGCCTGCGGGATGTTCCTGGCCATGGCGCACAGCAGCGCGATGCCGTGC
TCCGCCGCCGCCACGGTGTTGGCGGTGGGCGCGTTCACCACTAGGCAGCCCGCCTCCGTG
GCGGCGGCCAGGTCCACGTTGTCCACGCCCACGCCCGCGCGCCCCACCACCTTGAGCCGC
CCGTGGCTGGCCTCGAACACGGCGCGCGTCACCTTTGTCCCCGACCGCACAATCAGCGCA
TCCACCAGTGACACCTTGGCGCACAGCTCCTCCTGCGTCAGGCCGTACGCAGTCTCCACG
TTGCATGTCAGCCGCAGCCGGTCCAGGCCCGCATCACCCAGCTTCTCCGTGACCAGCACC
GTGGCCCGATGCGTCGCATACACAGCTTCTACCCGAGCGCAGCACCTGCGGCCGGCCGCC
GGCCGCCGAGCAGCAGCAGCGGAGCGGCGGACCGCTCGGTCCGCGAGGCTCCACGCCATG
TGCAAGCCGATCGAACACTTGCACCTAGTAGTATGAATTGGCTCCGCTTTATTTCAAATT
GCCCAGCGCCAAGATGGGTAAGACCCGTGGTATGGGAGCCGGGCGCAAGCTCCGGGTGCA
CCGCCGTGAGGAGCGCTGGGCCGACAAGGACTACAACAAGAGCCATCTGGGCTCTGAGTG
GAAGAAGCCCTTCGCCGGCGCTTCGCACGCCAAGGGCATTGTGCTGGAGAAGATCGGCAT
TGAGGCCAAGCAGCCCAACTCTGCCATTCGCAAGTGCGCGCGTGTGCAGCTGATCAAGAA
CGGCAAGAAGATTGCCGCCTTCGTCCCCATGGACGGTTGCCTGAACTTCATCGAGGAGAA
CGATGAGGTCCTGATCGCCGGTTTCGGTCGCCGCGGCCACGCCGTGGGTGATATTCCCGG
TGTCCGCTTCAAGGTGGTCAAGGTGTCGGGTGTGTCCCTGCTGGCGCTCTTCAAGGGCAA
GAAGGAGAAGCCCCGCTCGTAAGGGCGAGGCCGCGTGCGCGAGCAGCGGCTGTCGCCCCC
GGCTGCTGTAACGCGGGTGTGTGTCGGCGCTCTCCTTCCTCATGCCGGGGTCTCTCTGGG
TATGGGCATGGGAACAGCGCCACAGCGCA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000025A_C02 KCC000025A_c02
         (1109 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAB92932.1| 40S ribosomal protein S23 [Oryza sativa (japonic...   268  2e-70
sp|P46297|RS23_FRAAN 40S RIBOSOMAL PROTEIN S23 (S12) gi|1362041|...   264  2e-69
gb|AAF26742.1|AF220539_1 40s ribosomal protein S23 [Euphorbia es...   262  7e-69
ref|NP_195916.1| 40S ribosomal protein S23 (RPS23B) [Arabidopsis...   259  6e-68
ref|NP_566351.1| 40S ribosomal protein S23 (RPS23A) [Arabidopsis...   250  3e-65

>dbj|BAB92932.1| 40S ribosomal protein S23 [Oryza sativa (japonica cultivar-group)]
           gi|20805267|dbj|BAB92933.1| 40S ribosomal protein S23
           [Oryza sativa (japonica cultivar-group)]
           gi|21671347|dbj|BAC02683.1| 40S ribosomal protein [Oryza
           sativa (japonica cultivar-group)]
           gi|21671348|dbj|BAC02684.1| 40S ribosomal protein [Oryza
           sativa (japonica cultivar-group)]
           gi|28876025|gb|AAO60034.1| 40S ribosomal protein S23
           [Oryza sativa (japonica cultivar-group)]
           gi|29124115|gb|AAO65856.1| 40S ribosomal protein S23
           [Oryza sativa (japonica cultivar-group)]
          Length = 142

 Score =  268 bits (684), Expect = 2e-70
 Identities = 130/142 (91%), Positives = 136/142 (95%)
 Frame = +2

Query: 554 MGKTRGMGAGRKLRVHRREERWADKDYNKSHLGSEWKKPFAGASHAKGIVLEKIGIEAKQ 733
           MGKTRGMGAGRKL+ HRR +RWADK Y KSHLG+EWKKPFAG+SHAKGIVLEKIGIEAKQ
Sbjct: 1   MGKTRGMGAGRKLKTHRRNQRWADKAYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQ 60

Query: 734 PNSAIRKCARVQLIKNGKKIAAFVPMDGCLNFIEENDEVLIAGFGRRGHAVGDIPGVRFK 913
           PNSAIRKCARVQL+KNGKKIAAFVP DGCLNFIEENDEVLIAGFGR+GHAVGDIPGVRFK
Sbjct: 61  PNSAIRKCARVQLVKNGKKIAAFVPNDGCLNFIEENDEVLIAGFGRKGHAVGDIPGVRFK 120

Query: 914 VVKVSGVSLLALFKGKKEKPRS 979
           VVKVSGVSLLALFK KKEKPRS
Sbjct: 121 VVKVSGVSLLALFKEKKEKPRS 142

>sp|P46297|RS23_FRAAN 40S RIBOSOMAL PROTEIN S23 (S12) gi|1362041|pir||S56673 ribosomal
           protein S23.e, cytosolic (clone RJ3) - garden strawberry
           gi|643074|gb|AAA79921.1| putative 40S ribosomal protein
           s12
          Length = 142

 Score =  264 bits (675), Expect = 2e-69
 Identities = 129/142 (90%), Positives = 135/142 (94%)
 Frame = +2

Query: 554 MGKTRGMGAGRKLRVHRREERWADKDYNKSHLGSEWKKPFAGASHAKGIVLEKIGIEAKQ 733
           MGKTRGMGA RKL+ HRR +RWADK Y KSHLG+EWKKPFAG+SHAKGIVLEKIGIEAKQ
Sbjct: 1   MGKTRGMGAARKLKNHRRRQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQ 60

Query: 734 PNSAIRKCARVQLIKNGKKIAAFVPMDGCLNFIEENDEVLIAGFGRRGHAVGDIPGVRFK 913
           PNSAIRKCARVQLIKNGKKIAAFVP DGCLN+IEENDEVLIAGFGR+GHAVGDIPGVRFK
Sbjct: 61  PNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFK 120

Query: 914 VVKVSGVSLLALFKGKKEKPRS 979
           VVKVSGVSLLALFK KKEKPRS
Sbjct: 121 VVKVSGVSLLALFKEKKEKPRS 142

>gb|AAF26742.1|AF220539_1 40s ribosomal protein S23 [Euphorbia esula]
          Length = 142

 Score =  262 bits (670), Expect = 7e-69
 Identities = 128/142 (90%), Positives = 134/142 (94%)
 Frame = +2

Query: 554 MGKTRGMGAGRKLRVHRREERWADKDYNKSHLGSEWKKPFAGASHAKGIVLEKIGIEAKQ 733
           MGKT GMGA RKL+ HRR +RWADK Y KSHLG+EWKKPFAG+SHAKGIVLEKIGIEAKQ
Sbjct: 1   MGKTHGMGAARKLKSHRRTQRWADKSYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQ 60

Query: 734 PNSAIRKCARVQLIKNGKKIAAFVPMDGCLNFIEENDEVLIAGFGRRGHAVGDIPGVRFK 913
           PNSAIRKCARVQLIKNGKKIAAFVP DGCLN+IEENDEVLIAGFGR+GHAVGDIPGVRFK
Sbjct: 61  PNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFK 120

Query: 914 VVKVSGVSLLALFKGKKEKPRS 979
           VVKVSGVSLLALFK KKEKPRS
Sbjct: 121 VVKVSGVSLLALFKEKKEKPRS 142

>ref|NP_195916.1| 40S ribosomal protein S23 (RPS23B) [Arabidopsis thaliana]
           gi|27735238|sp|P49201|R23B_ARATH 40S ribosomal protein
           S23-2 (S12) gi|11276598|pir||T48317 hypothetical protein
           F9G14.270 - Arabidopsis thaliana
           gi|7413571|emb|CAB86050.1| putative protein [Arabidopsis
           thaliana] gi|14532718|gb|AAK64160.1| unknown protein
           [Arabidopsis thaliana] gi|15450459|gb|AAK96523.1|
           AT5g02960/F9G14_270 [Arabidopsis thaliana]
           gi|21281137|gb|AAM44979.1| unknown protein [Arabidopsis
           thaliana]
          Length = 142

 Score =  259 bits (662), Expect = 6e-68
 Identities = 128/142 (90%), Positives = 134/142 (94%)
 Frame = +2

Query: 554 MGKTRGMGAGRKLRVHRREERWADKDYNKSHLGSEWKKPFAGASHAKGIVLEKIGIEAKQ 733
           MGKTRGMGAGRKL+  R  +RWADK Y KSHLG+EWKKPFAG+SHAKGIVLEKIGIEAKQ
Sbjct: 1   MGKTRGMGAGRKLKRLRINQRWADKQYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQ 60

Query: 734 PNSAIRKCARVQLIKNGKKIAAFVPMDGCLNFIEENDEVLIAGFGRRGHAVGDIPGVRFK 913
           PNSAIRKCARVQLIKNGKKIAAFVP DGCLN+IEENDEVLIAGFGR+GHAVGDIPGVRFK
Sbjct: 61  PNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFK 120

Query: 914 VVKVSGVSLLALFKGKKEKPRS 979
           VVKVSGVSLLALFK KKEKPRS
Sbjct: 121 VVKVSGVSLLALFKEKKEKPRS 142

>ref|NP_566351.1| 40S ribosomal protein S23 (RPS23A) [Arabidopsis thaliana]
           gi|27734450|sp|Q9SF35|R23A_ARATH 40S ribosomal protein
           S23-1 (S12) gi|21536723|gb|AAM61055.1| putative 40S
           ribosomal protein S23 [Arabidopsis thaliana]
          Length = 142

 Score =  250 bits (639), Expect = 3e-65
 Identities = 125/142 (88%), Positives = 132/142 (92%)
 Frame = +2

Query: 554 MGKTRGMGAGRKLRVHRREERWADKDYNKSHLGSEWKKPFAGASHAKGIVLEKIGIEAKQ 733
           MGKTRGMGAGRKL+  R  +RWADK Y KS+ G+EWKKPFA +SHAKGIVLEKIGIEAKQ
Sbjct: 1   MGKTRGMGAGRKLKQLRITQRWADKHYKKSNRGNEWKKPFACSSHAKGIVLEKIGIEAKQ 60

Query: 734 PNSAIRKCARVQLIKNGKKIAAFVPMDGCLNFIEENDEVLIAGFGRRGHAVGDIPGVRFK 913
           PNSAIRKCARVQLIKNGKKIAAFVP DGCLN+IEENDEVLIAGFGR+GHAVGDIPGVRFK
Sbjct: 61  PNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFK 120

Query: 914 VVKVSGVSLLALFKGKKEKPRS 979
           VVKVSGVSLLALFK KKEKPRS
Sbjct: 121 VVKVSGVSLLALFKEKKEKPRS 142



EST assemble image


clone accession position
1 CL36b11_r AV395160 1 521
2 CL77a08_r AV397245 338 943
3 HC073h07_r AV637501 428 1041
4 CL18f06_r AV394046 443 1062
5 CL62h01_r AV396433 445 1119
6 CL75d09_r AV397046 445 1119
7 CL58g03_r AV396215 446 1043
8 CL53b05_r AV395969 446 1122
9 CL08e07_r AV393516 446 1120
10 CL66g02_r AV396727 453 1119
11 CL35c12_r AV395060 461 1121
12 CL29a08_r AV394677 482 1055
13 CL73g03_r AV396987 501 1119
14 CL49a05_r AV397720 519 826
15 LCL027d07_r AV627483 523 866
16 LCL068a09_r AV629871 526 1055
17 LCL050b04_r AV628997 527 832
18 LCL099c03_r AV631753 527 1010
19 CL33a03_r AV394977 527 1113
20 LC072g03_r AV624083 527 1119
21 LC032c12_r AV621179 527 1027
22 LC001g05_r AV618947 527 1136
23 LC035d09_r AV621393 528 1118
24 CM084f09_r AV392594 529 1109
25 CL07d02_r AV393470 530 1116
26 CL22h04_r AV394217 531 1127
27 CL35e10_r AV395084 533 1119
28 CL15d05_r AV393983 534 1124
29 CL78a06_r AV397218 535 1093
30 CM042e06_r AV389260 535 874
31 CL32d10_r AV394846 535 1119
32 CL71c09_r AV396906 536 1119
33 CL80g05_r AV397306 536 1119
34 CL34e07_r AV394934 536 1119
35 MXL043h02_r BP095559 537 958
36 CL15e07_r AV393959 537 1079
37 CL25g09_r AV394551 537 1082
38 CL69h08_r AV396777 537 1042
39 CL38d01_r AV395286 537 977
40 HC082e07_r AV638146 537 1020
41 HC052b08_r AV635878 537 1028
42 CL75d03_r AV397095 537 1119
43 HC024h12_r AV633764 537 1044
44 CL44c08_r AV395624 537 1046
45 MXL025d04_r BP094591 537 1047
46 CL63a09_r AV396547 537 1119
47 CL28g03_r AV394785 537 1118
48 CL30e04_r AV394734 537 1119
49 CL53g03_r AV395953 537 1118
50 CL26e05_r AV394609 537 1104
51 CL55h11_r AV396063 537 1118
52 CL64e10_r AV396627 537 1119
53 HC030a07_r AV634163 537 1119
54 CL19h04_r AV394180 537 1095
55 LC039d05_r AV621668 537 1121
56 CL26h03_r AV394610 537 1125
57 CL55a04_r AV396020 537 1089
58 LC031b01_r AV621090 537 1089
59 CL10g06_r AV393666 537 1083
60 CL26c08_r AV394585 537 1127
61 CL22a02_r AV394226 537 1124
62 CL15b02_r AV393939 537 1080
63 CL55g09_r AV396012 537 1082
64 LC073h08_r AV624170 537 1078
65 CL56g08_r AV396118 537 1128
66 CL38c10_r AV395326 537 1137
67 CL15b03_r AV393953 537 1147
68 CL29c02_r AV394649 537 1076
69 CM066c09_r AV390873 537 1210
70 CM070g08_r AV391309 538 1207
71 CL56e04_r AV396087 538 1084
72 CL04a08_r AV393392 538 1127
73 CL78a07_r AV397201 538 1121
74 CL48b06_r AV395828 539 1120
75 CL34a12_r AV394937 540 1096
76 CL58g04_r AV396222 541 1078
77 CL03e10_r AV393422 541 1121
78 HC039d02_r AV634893 542 1089
79 CL70g07_r AV396837 542 1119
80 CL16g07_r AV394020 542 1121
81 CL28a05_r AV394802 543 1124
82 CL07d07_r AV393460 543 1127
83 CL34a06_r AV394887 543 1119
84 CL19a05_r AV394166 543 1116
85 CL78c06_r AV397221 543 1119
86 HC089c06_r AV638672 543 1019
87 CL34b06_r AV394889 543 1121
88 CL32b04_r AV394850 543 1097
89 CL78d04_r AV397194 543 1156
90 MXL066c06_r BP096876 544 1014
91 CM032g06_r AV388489 544 1171
92 HC024h11_r AV633763 544 1132
93 CL68a03_r AV396911 544 1120
94 CL80a08_r AV397320 546 1119
95 MX245h05_r BP091898 547 1046
96 CL77a07_r AV397251 547 1119
97 CM045f03_r AV389724 547 1141
98 CL21b02_r AV394355 548 1078
99 LCL070e04_r AV629987 548 839
100 CL01h04_r AV393359 548 1146
101 CL32g04_r AV394856 549 1111
102 LC099e12_r AV625900 549 897
103 LC069h01_r AV623873 549 1062
104 CL68c08_r AV396949 549 1119
105 CL38f11_r AV395333 549 1119
106 CL74a04_r AV396477 550 1119
107 MX033c09_r BP087377 550 1159
108 LC093e12_r AV625490 551 1082
109 CL45b06_r AV397775 552 1114
110 MXL074d01_r BP097352 553 994
111 CL01f03_r AV393350 553 947
112 CL76b11_r AV397128 559 1119
113 HC099h01_r AV639475 559 1032
114 CL37d03_r AV395256 560 1038
115 LC028a06_r AV620877 560 1185
116 MXL017c09_r BP094040 560 967
117 CL41b02_r AV395436 560 1052
118 CL25e04_r AV394524 560 1119
119 HC095a10_r AV639106 563 1054
120 CL31c02_r AV395024 565 1144
121 LCL070c08_r AV629974 569 1104
122 CL56g01_r AV396076 596 1132
123 LC039f11_r AV621690 599 1165
124 CL10h07_r AV393700 617 1104
125 CL47e12_r AV395711 622 1119
126 MX202g12_r BP089208 671 1134
127 MX102a08_r BP088869 679 1119
128 MX104h03_r BP089106 703 1119
129 CM091c07_r AV397551 708 1071
130 CL21g08_r AV394401 724 1120
131 MX101b08_r BP088795 780 1248
132 CM005a05_r AV386858 833 1119
133 MX101b09_r BP088796 835 1117
134 CM032b07_r AV388459 897 1119




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research