KCC000024A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000024A_C01 KCC000024A_c01
cgggagcgggcgcctcctggcaacggaaaacatcggcttgtcgcccgatgcagcggggga
ctcgctcggtcggcaaaagcACCAGCCTGCGCTTGAACAAACCCTCTTCACCACTGCCGC
TTTTGTAGCTGTTGCAAGTTAGTCAGCAAAAATGTCGTGCTCAGCTGGTTTGGGAGTGCA
TCAAGGGCCACAACAGCAAGCTGCGCAAGGCCGCCAAGGGCATTGTGTTCAGCGCTGAGG
CCGGCAACCTGTACAACAAGCACAGCTACAAGTACTCGGGCCTGGTGAACGCCAAGACCG
TGGACGTTGCCGCTGATGGCGAGGCCGTCAAGCTGACCGTGGGCCGCGTGAAGAACGCGA
GCAAGCCCAGCGTGTCCAAGTTCAGCATGACCATGAAGAAGCACAGCCGCGGCGTGTGCG
CCGCCGTGGGCAAGCAGGTGTCCAGCTACCGGCCAGACCTGAAGGCCGCTGCCCAGGCCC
GCGCCGCCGCCGTGCACAAGAGCATCCGCGTTGCCCGCGCCAACAAGAAGTAAATGGATC
GTGGCAGCCAGGAGCAGAGCTGTGTGGGCTGCGGCTGCCGCGGCCGGCGCTGCGCGCTGT
CGAGGCGGGCGCGCTTAGGCTGAGGGAGCTGGCGGCGTGTGTGGGGTGTCGCAGGAGGCG
GGTGCCTCGGCACCGGAATGTGTAACCGCTGAGTTCGAAAAAAAAAAAAAAAAAAA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000024A_C01 KCC000024A_c01
         (716 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_179563.1| 60S ribosomal protein L28 (RPL28A) [Arabidopsis...    89  7e-17
dbj|BAB86520.1| ribosomal protein L28-like [Oryza sativa (japoni...    86  4e-16
ref|NP_194670.1| 60S ribosomal protein L28 (RPL28C) [Arabidopsis...    84  2e-15
ref|XP_326065.1| predicted protein [Neurospora crassa] gi|289245...    78  1e-13
sp|Q9GS21|RL28_DICDI 60S ribosomal protein L28 gi|11245768|gb|AA...    75  1e-12

>ref|NP_179563.1| 60S ribosomal protein L28 (RPL28A) [Arabidopsis thaliana]
           gi|25295483|pir||D84580 probable ribosomal protein L28
           [imported] - Arabidopsis thaliana
           gi|3687251|gb|AAC62149.1| putative ribosomal protein L28
           [Arabidopsis thaliana] gi|15292671|gb|AAK92704.1|
           putative ribosomal protein L28 [Arabidopsis thaliana]
           gi|19310757|gb|AAL85109.1| putative ribosomal protein
           L28 [Arabidopsis thaliana]
          Length = 143

 Score = 89.0 bits (219), Expect = 7e-17
 Identities = 59/135 (43%), Positives = 79/135 (57%), Gaps = 8/135 (5%)
 Frame = +3

Query: 162 QLVWECIKGHNSKLRKA-AKG---IVFSAEAGNLYNKHSYKYSGLVNAKTVDV-AAD-GE 323
           QL+WE +K +N  L K   +G   + FS E  NL N HSYK+SGL N KTV + AAD  +
Sbjct: 7   QLIWEIVKNNNCFLVKQFGRGNSKVQFSKETNNLTNVHSYKHSGLANKKTVTIQAADKDQ 66

Query: 324 AVKLTVGRVKNASKPSVSKFSMTMKKHSRGVCAAVGKQV--SSYRPDLKAAAQARAAAVH 497
           AV L   + K  +KP +S     +KK    +  AV  QV  + YRPDLK AA AR +A+ 
Sbjct: 67  AVVLATTKTKKQNKPKLSVNKSILKKEFPRMSKAVANQVVDNYYRPDLKKAALARLSAIS 126

Query: 498 KSIRVARANKK*MDR 542
           K +RVA++  K  +R
Sbjct: 127 KGLRVAKSGAKQRNR 141

>dbj|BAB86520.1| ribosomal protein L28-like [Oryza sativa (japonica cultivar-group)]
           gi|20804640|dbj|BAB92329.1| ribosomal protein L28-like
           [Oryza sativa (japonica cultivar-group)]
          Length = 145

 Score = 86.3 bits (212), Expect = 4e-16
 Identities = 58/135 (42%), Positives = 78/135 (56%), Gaps = 9/135 (6%)
 Frame = +3

Query: 165 LVWECIKGHNSKLRKAAKG----IVFSAEAGNLYNKHSYKYSGLVNAKTVDV-AADGE-- 323
           LVWE +K +NS L K        + FS E  NLYN HSYK+SGL N KTV V  A G+  
Sbjct: 8   LVWELVKKNNSFLVKQFGNGNAKVQFSKEPNNLYNVHSYKHSGLANKKTVTVQPASGKET 67

Query: 324 AVKLTVGRVKNASKPSVSKFSMTMKKHSRGVCAAVGKQVSS--YRPDLKAAAQARAAAVH 497
           AV L+  + +  +KP+       M+K  R +  AV  QVS   YRPDL   A AR +AV+
Sbjct: 68  AVVLSTTKTEKQNKPASLYHKSVMRKEFRKMAKAVKNQVSDNYYRPDLTKPALARLSAVY 127

Query: 498 KSIRVARANKK*MDR 542
           +S++VA++  K  +R
Sbjct: 128 RSLQVAKSGVKKKNR 142

>ref|NP_194670.1| 60S ribosomal protein L28 (RPL28C) [Arabidopsis thaliana]
           gi|25295482|pir||B85343 hypothetical protein AT4g29410
           [imported] - Arabidopsis thaliana
           gi|7269839|emb|CAB79699.1| putative protein [Arabidopsis
           thaliana] gi|18252205|gb|AAL61935.1| putative protein
           [Arabidopsis thaliana] gi|21593876|gb|AAM65843.1|
           putative ribosomal protein L28 [Arabidopsis thaliana]
           gi|23197678|gb|AAN15366.1| putative protein [Arabidopsis
           thaliana]
          Length = 143

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 55/135 (40%), Positives = 77/135 (56%), Gaps = 8/135 (5%)
 Frame = +3

Query: 162 QLVWECIKGHNSKLRKA-AKG---IVFSAEAGNLYNKHSYKYSGLVNAKTVDVAADG--E 323
           QL+WE +K +N  L K   +G   + FS E+ NL N +SYK+SGL N KTV + A G  +
Sbjct: 7   QLIWEIVKRNNCFLVKQFGRGNAKVQFSKESNNLVNINSYKHSGLANKKTVTIQAAGKDQ 66

Query: 324 AVKLTVGRVKNASKPSVSKFSMTMKKHSRGVCAAVGKQV--SSYRPDLKAAAQARAAAVH 497
            V L   + K  +KP +S     +KK    +   V  QV  + YRPDLK AA AR +A+ 
Sbjct: 67  GVVLGTTKTKRQNKPKLSVNKSILKKEFSRMSKVVANQVVDNYYRPDLKKAALARLSAIS 126

Query: 498 KSIRVARANKK*MDR 542
           K +RVA++  K  +R
Sbjct: 127 KGLRVAKSGPKRRNR 141

>ref|XP_326065.1| predicted protein [Neurospora crassa] gi|28924570|gb|EAA33690.1|
           predicted protein [Neurospora crassa]
          Length = 150

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 49/131 (37%), Positives = 71/131 (53%), Gaps = 4/131 (3%)
 Frame = +3

Query: 138 VSQQKCRAQLVWECIKGHNSKL--RKAAKGIVFSAEAGNLYNKHSYKYSGLVNAKTVDVA 311
           +S     A L+WE  + HNS L  RK+  G+ FS +  NL NKHS KY+G VN K V V 
Sbjct: 1   MSLSNVSADLIWEITRSHNSFLVKRKSGGGVQFSRDPLNLTNKHSRKYAGFVNDKAVGVV 60

Query: 312 -ADGEAVKLTVGRVKNASKPSVS-KFSMTMKKHSRGVCAAVGKQVSSYRPDLKAAAQARA 485
             +   V +T  +  + +KP+     +    K +R    A+ +QV+ YR DL  AA ARA
Sbjct: 61  PGEKGGVVVTTKKAGSINKPAARYTVAFGANKTARKTYKAIARQVAGYRSDLLKAAVARA 120

Query: 486 AAVHKSIRVAR 518
           +A+ +S R  +
Sbjct: 121 SAIRRSQRAVK 131

>sp|Q9GS21|RL28_DICDI 60S ribosomal protein L28 gi|11245768|gb|AAG32533.1| ribosomal
           protein L28 [Dictyostelium discoideum]
          Length = 132

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 48/119 (40%), Positives = 68/119 (56%), Gaps = 1/119 (0%)
 Frame = +3

Query: 165 LVWECIKGHNSKLRKAAKGIVFSAEAGNLYNKHSYKYSGLVNAKTVDVAADGEAVKLTVG 344
           LVW  IK +N+ L K++ G+  SAE GNL NK+S KYSGL    T+DVAA    V ++  
Sbjct: 5   LVWSIIKKNNAFL-KSSHGLTLSAEPGNLRNKNSLKYSGLARRTTIDVAAVNGKVVVSSK 63

Query: 345 RVKNASKPSVSKFSMTMKK-HSRGVCAAVGKQVSSYRPDLKAAAQARAAAVHKSIRVAR 518
            VK A+ P+ SK + T    ++R     V    + Y P+L+AAA  R   V  ++R A+
Sbjct: 64  IVKKAAFPAQSKKTTTFSTVNTRKTARFVKTLATQYAPELRAAALGRLHRVQSALRSAK 122



EST assemble image


clone accession position
1 MX214b04_r BP089802 1 309
2 CL36f06_r AV395121 33 640
3 CL21b09_r AV394382 36 657
4 CL22f05_r AV394244 124 603
5 CL14d05_r AV393888 125 631
6 CL24e06_r AV394449 125 422
7 CL73f01_r AV396970 125 684
8 CL36h10_r AV395168 125 662
9 HC002a12_r AV631949 125 661
10 MXL078e09_r BP097617 125 452
11 CL33e01_r AV394966 125 630
12 CL18e11_r AV394049 125 551
13 CL66b01_r AV396736 125 693
14 CL27d08_r AV394721 125 589
15 HCL036c09_r AV641560 125 409
16 CL06h03_r AV393612 125 454
17 CL06f07_r AV393615 126 582
18 MXL016a03_r BP093939 128 432
19 CL04c09_r AV393386 129 683
20 CM024h02_r AV388260 129 722
21 HCL041a06_r AV641831 131 512
22 CL76h02_r AV397119 132 721
23 CL66a06_r AV396725 132 677
24 LC093f02_r AV625492 132 525
25 CL08d09_r AV393524 133 646
26 CL37h08_r AV395228 133 660
27 MX050f03_r BP088061 134 496
28 CL72f09_r AV397008 134 667
29 CL70f06_r AV396850 134 661
30 CL33b11_r AV394944 134 623
31 HC075e09_r AV637628 134 589
32 CL31h12_r AV395022 135 666
33 CL55g11_r AV396062 135 616
34 CL35e03_r AV395100 135 649
35 HC035h07_r AV634639 135 628
36 CL34a08_r AV394921 135 641
37 CL58c08_r AV396218 135 661
38 MX063h12_r BP088573 137 481
39 MX064a07_r BP088576 137 487
40 HC066h03_r AV636970 138 684
41 MX037h06_r BP087579 138 644
42 CL41b09_r AV395405 139 586
43 CL27c07_r AV394730 142 654
44 CL60h12_r AV396357 146 709
45 CL01e09_r AV393328 147 661
46 HC075e05_r AV637624 147 504
47 CL37c05_r AV395259 147 622
48 CL43c11_r AV395529 147 650
49 MXL052e07_r BP096091 147 572
50 CM088b02_r AV393070 152 715
51 CL51d09_r AV395918 158 666
52 HCL091b07_r AV644604 167 416
53 MX027c04_r BP087173 173 560
54 CL62f09_r AV396440 174 695
55 CL09a07_r AV393735 182 681
56 MX102b06_r BP088879 201 709
57 MX103f06_r BP089000 217 709
58 CL55h09_r AV396013 217 727
59 CL24c10_r AV394420 218 720
60 MX102d05_r BP088896 219 709
61 MX104g09_r BP089101 246 709
62 CM083b07_r AV392204 254 589
63 MX104a06_r BP089031 259 825
64 CL07e09_r AV393494 263 701
65 CL68h04_r AV396951 278 709
66 CL13f09_r AV393923 298 709
67 MX102g08_r BP088928 311 709
68 MX101f08_r BP088837 315 822
69 CM084h06_r AV392586 318 728
70 MX104d04_r BP089063 321 825
71 MX102e10_r BP088910 322 821
72 MX102c12_r BP088892 326 822
73 MX103h01_r BP089017 329 709
74 MX102a12_r BP088873 367 828




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research