KCC000023A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000023A_C01 KCC000023A_c01
CGCGGAGCCTGCCCCTCCGTGCGAAAATGGTGCTCTCCAGTGATATCGATCTTCTGAACC
CTCCAGCTGAGCTGGAGAAGACGAAGCACAAGCGGAAGCGCCTTGTGCAGAGCCCCAACT
CGTTCTTCATGGACGTCAAGTGCCAGGGCTGCTTCAACATCACCACCGTCTTCTCTCACA
GCCAGACGGTCGTCATGTGCGGGAGCTGCTCGTCTGTTCTGTGCACCCCTACCGGTGGCC
GCGCCCGCCTGACCGAGGGCTGCTCTTTCCGCCGGAAGAGCGACTAAGCGGGAGGATTTG
GGCGCCACCTTGGCGCCGGGAGCCGGGCCTTCCGCTGGGCTGGCGGCGGGGGTGTCGGGC
AGTAGAACAGCGTTCACCGTGAGCATGGCAGACGGTCAGCTGGAGCCCAGCCCCAGCCAG
GACAACAGGAGTAGCGTGCAGGCTTCTTTTTGAGGAGGGGCCTTCGAACGGACCCGAGCT
GCCTTGGTGGCAGGGGCTCCGTGTCCATAGCCGGTATGCGCGCATGTTGGACCATGCCTG
GCAAGCCGCCGTGCGGTTTGCTGTTGACCATTGTTGCGTGTGTAACGGTCGCTGCATACA
AAAAAAAAAAAAAAAAACTCGAG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000023A_C01 KCC000023A_c01
         (623 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P47903|RS27_CHLRE 40S ribosomal protein S27 gi|1076217|pir||S...   172  4e-42
emb|CAD40354.1| OSJNBa0020I02.1 [Oryza sativa (japonica cultivar...   163  2e-39
ref|NP_191670.1| 40S ribosomal protein S27 (RPS27B) [Arabidopsis...   160  1e-38
ref|NP_182095.1| 40S ribosomal protein S27 (RPS27A) [Arabidopsis...   160  2e-38
emb|CAA59732.2| putative zinc finger protein [Hordeum vulgare su...   160  2e-38

>sp|P47903|RS27_CHLRE 40S ribosomal protein S27 gi|1076217|pir||S51146 ribosomal protein
           S27.e, cytosolic - Chlamydomonas reinhardtii
           gi|624959|emb|CAA58669.1| ribosomal protein S27
           [Chlamydomonas reinhardtii] gi|1587085|prf||2205351B
           ribosomal protein S27
          Length = 86

 Score =  172 bits (436), Expect = 4e-42
 Identities = 83/86 (96%), Positives = 83/86 (96%)
 Frame = +3

Query: 27  MVLSSDIDLLNPPAELEKTKHKRKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGS 206
           MVLSSDIDLLNPPAELEKTKHKRKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGS
Sbjct: 1   MVLSSDIDLLNPPAELEKTKHKRKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGS 60

Query: 207 CSSVLCTPTGGRARLTEGCSFRRKSD 284
           CSSVLCTPTG   RLTEGCSFRRKSD
Sbjct: 61  CSSVLCTPTGWPRRLTEGCSFRRKSD 86

>emb|CAD40354.1| OSJNBa0020I02.1 [Oryza sativa (japonica cultivar-group)]
          Length = 86

 Score =  163 bits (412), Expect = 2e-39
 Identities = 76/86 (88%), Positives = 81/86 (93%)
 Frame = +3

Query: 27  MVLSSDIDLLNPPAELEKTKHKRKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGS 206
           MVLS+DIDLLNPPAELEK KHK+KRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV+C  
Sbjct: 1   MVLSNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCPG 60

Query: 207 CSSVLCTPTGGRARLTEGCSFRRKSD 284
           C +VLC PTGG+ARLTEGCSFRRKSD
Sbjct: 61  CQTVLCQPTGGKARLTEGCSFRRKSD 86

>ref|NP_191670.1| 40S ribosomal protein S27 (RPS27B) [Arabidopsis thaliana]
           gi|11276658|pir||T50532 ribosomal protein S27 -
           Arabidopsis thaliana gi|4193382|gb|AAD10029.1| ribosomal
           protein S27 [Arabidopsis thaliana]
           gi|4193384|gb|AAD10030.1| ribosomal protein S27
           [Arabidopsis thaliana] gi|8388627|emb|CAB94147.1|
           ribosomal protein S27 [Arabidopsis thaliana]
           gi|15724226|gb|AAL06506.1|AF412053_1
           AT3g61110/T27I15_200 [Arabidopsis thaliana]
           gi|19699108|gb|AAL90920.1| AT3g61110/T27I15_200
           [Arabidopsis thaliana]
          Length = 86

 Score =  160 bits (405), Expect = 1e-38
 Identities = 73/86 (84%), Positives = 80/86 (92%)
 Frame = +3

Query: 27  MVLSSDIDLLNPPAELEKTKHKRKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGS 206
           MVL +DIDLLNPPAELEK KHK KRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV+CG+
Sbjct: 1   MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN 60

Query: 207 CSSVLCTPTGGRARLTEGCSFRRKSD 284
           C ++LC PTGG+A+LTEGCSFRRK D
Sbjct: 61  CQTILCQPTGGKAKLTEGCSFRRKGD 86

>ref|NP_182095.1| 40S ribosomal protein S27 (RPS27A) [Arabidopsis thaliana]
           gi|7440568|pir||T02476 40S ribosomal protein S27
           [imported] - Arabidopsis thaliana
           gi|3386624|gb|AAC28554.1| putative ribosomal protein S27
           [Arabidopsis thaliana] gi|18252883|gb|AAL62368.1|
           putative ribosomal protein S27 [Arabidopsis thaliana]
           gi|20197050|gb|AAM14895.1| putative ribosomal protein
           S27 [Arabidopsis thaliana] gi|21553959|gb|AAM63040.1|
           putative ribosomal protein S27 [Arabidopsis thaliana]
           gi|23197762|gb|AAN15408.1| putative ribosomal protein
           S27 [Arabidopsis thaliana]
          Length = 84

 Score =  160 bits (404), Expect = 2e-38
 Identities = 73/84 (86%), Positives = 80/84 (94%)
 Frame = +3

Query: 27  MVLSSDIDLLNPPAELEKTKHKRKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGS 206
           MVL +DIDLLNPPAELEK KHK KRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCG+
Sbjct: 1   MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGN 60

Query: 207 CSSVLCTPTGGRARLTEGCSFRRK 278
           C ++LCTPTGG+A+LTEGCSFR+K
Sbjct: 61  CQTLLCTPTGGKAKLTEGCSFRKK 84

>emb|CAA59732.2| putative zinc finger protein [Hordeum vulgare subsp. vulgare]
           gi|14495006|emb|CAC42134.1| putative ribosomal protein
           S27 [Hordeum vulgare subsp. vulgare]
           gi|14495008|emb|CAC42162.1| putative ribosomal protein
           S27 [Hordeum vulgare subsp. vulgare]
           gi|14495010|emb|CAC42163.1| putative ribosomal protein
           S27 [Hordeum vulgare subsp. vulgare]
          Length = 86

 Score =  160 bits (404), Expect = 2e-38
 Identities = 74/86 (86%), Positives = 79/86 (91%)
 Frame = +3

Query: 27  MVLSSDIDLLNPPAELEKTKHKRKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGS 206
           MVL +DIDLLNPPAELEK KHK+KRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVV+C  
Sbjct: 1   MVLQNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCPG 60

Query: 207 CSSVLCTPTGGRARLTEGCSFRRKSD 284
           C +VLC PTGG+ARLTEGCSFRRK D
Sbjct: 61  CQTVLCQPTGGKARLTEGCSFRRKGD 86



EST assemble image


clone accession position
1 MX220g05_r BP090227 1 530
2 CL55c03_r AV396032 4 604
3 CL76c03_r AV397109 5 674
4 CL11b09_r AV393768 7 613
5 CL59b06_r AV397910 11 659
6 CL62d03_r AV396410 16 573
7 CL17f10_r AV394118 24 646
8 HCL097h07_r AV394118 84 572
9 CS001a04_r AV397936 89 655
10 CL18f08_r AV394080 89 621
11 CL04c10_r AV393389 89 662
12 CS001e03_r AV397956 89 653
13 CL12d03_r AV393802 89 622
14 MXL093g03_r BP098467 91 503
15 CM042d06_r AV389259 92 346
16 MXL002b08_r BP093015 92 545
17 CM047a08_r AV388594 93 438
18 LC045c11_r AV622263 94 646
19 HC056f11_r AV636223 94 578
20 LC009e01_r AV619519 94 666
21 MXL017e09_r BP094057 94 445
22 MX020h03_r BP086936 95 489
23 CS001g01_r AV398007 95 666
24 MXL024h10_r BP094558 95 627
25 LC079d08_r AV624560 95 598
26 CL72d12_r AV397030 95 688
27 CM072b01_r AV391478 96 729
28 CL13b12_r AV393906 96 622
29 CL14c02_r AV393874 96 602
30 CM009g04_r AV397635 96 711
31 MXL011f01_r BP093658 96 424
32 MX027h08_r BP087196 96 496
33 MX202h05_r BP089211 96 538
34 CL08b11_r AV393544 96 654
35 MXL016g06_r BP093998 96 563
36 CM004a06_r AV386659 96 686
37 CL33c10_r AV394953 97 577
38 CL49b03_r AV397742 97 624
39 CL15h03_r AV393958 97 602
40 CL27g01_r AV394702 97 525
41 CL78f07_r AV397207 97 612
42 MXL064h02_r BP096784 97 623
43 CL75c12_r AV397057 97 656
44 CL77d09_r AV397287 97 655
45 CL41g09_r AV395410 97 468
46 LC022a11_r AV620430 97 657
47 CL19e07_r AV394190 97 566
48 CL43e10_r AV395549 97 571
49 MXL066e02_r BP096887 97 560
50 CL65h07_r AV396591 97 671
51 MXL067e01_r BP096947 97 521
52 MXL005h05_r BP093266 98 599
53 CL31d12_r AV395018 98 657
54 CL34c03_r AV394927 98 646
55 CL26d07_r AV394612 98 680
56 CL24d10_r AV394421 98 629
57 HC090e05_r AV638765 98 557
58 CL18f03_r AV394085 98 604
59 CL53f10_r AV396003 98 656
60 MXL057g09_r BP096378 98 534
61 CL45f10_r AV397805 99 606
62 CL28h12_r AV394792 99 622
63 LCL031b02_r AV627722 99 445
64 MX103d08_r BP088981 101 515
65 MX104b05_r BP089041 101 574
66 MX103d06_r BP088979 101 519
67 MX103a12_r BP088953 101 524
68 MX102e03_r BP088903 101 566
69 MX102f03_r BP088914 101 608
70 MX104e08_r BP089077 101 657
71 MX104f11_r BP089092 101 659
72 MXL001h11_r BP092994 101 606
73 HCL087c05_r AV644371 101 571
74 MX101g08_r BP088848 101 505
75 CL10b09_r AV393678 102 477
76 CL10c08_r AV393690 102 657
77 CL06f03_r AV393611 102 533
78 CL72c09_r AV397006 103 654
79 CL31g08_r AV395003 103 608
80 MXL064h08_r BP096788 103 502
81 MX053h01_r BP088199 103 479
82 CL14c12_r AV393869 103 612
83 CL36f10_r AV395165 103 653
84 MXL072a06_r BP097220 103 509
85 CL20h11_r AV394310 106 521
86 MX232h11_r BP091044 107 393
87 CL01e08_r AV393326 109 653
88 CL08b10_r AV393529 109 656
89 CL07c12_r AV393466 109 673
90 MXL062d12_r BP096652 111 512
91 CL09h10_r AV393725 111 647
92 CL21g07_r AV394348 111 667
93 CL72f07_r AV397028 111 657
94 CL05d07_r AV393554 115 647
95 CL22b06_r AV394229 115 654
96 CL79d07_r AV397165 115 668
97 CL37e08_r AV395222 115 595
98 CL79a08_r AV397151 116 657
99 CL29e02_r AV394650 116 644
100 MXL029b12_r BP094771 116 569
101 MX047c08_r BP087931 117 573
102 CL35a12_r AV395059 117 717
103 HCL097h06_r AV645075 117 563
104 CL32g08_r AV394860 117 670
105 MX259d12_r BP092808 117 661
106 CL22b11_r AV394260 117 496
107 CL24f11_r AV394457 117 557
108 CL18e05_r AV394057 118 614
109 CL40f08_r AV395365 123 539
110 LCL074e10_r AV630162 130 545
111 CL79d10_r AV397183 146 653
112 CM053b03_r AV389954 147 730
113 CM019h05_r AV387310 149 669
114 CL63c12_r AV396527 164 722
115 CL72c11_r AV397040 169 722
116 CL20f10_r AV394326 170 722
117 CL79g07_r AV397167 178 848
118 CL07g08_r AV393454 182 735
119 CL61d06_r AV396323 188 657
120 MXL040g02_r BP095368 198 625
121 CL09d03_r AV393734 252 730
122 CL79a03_r AV397157 259 851
123 HCL014g04_r AV640352 369 728
124 CL34e11_r AV394898 379 728




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research