KCC000022A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000022A_C01 KCC000022A_c01
GGACGGCACTGTAACCACTGCCTAGTACCTGTCAGAATGCAGATTTTCGTCCTGGACTGA
CCGGACTCACCTCGTTGAGGTGAGTCCTGGCGCAGACCGTCGCCGATGTGAAGGCTGCCG
TGGAGGCTCTGCAGGGCCTGGAGGCCGGCGAGCAGCGCATCCTGTTCAACGGTGTGCAGC
TGGAGGACTCCCAGGTCCTGGCTGAGTGCCTGGTGTCAGCGATGACAGCACCCTGATGTG
CCTGCTGCGCCTGCTGGGTGGTGCCAAGAAGCGCAAGAAGAAGACGTACACCAAGCCCAA
GAAGCAGAAGCACAAGCACAAGAAGATCAAGCTCCGGGTGCTGAAGTTCTACAAGGTGGA
CTGACTCCTGGCAAGGTCCAGCGCCTGCTGCAAGCAGTGCCCCAACTGCGGCCCCGGCAC
GTTCATGGCCACCCACTTCGACCGCGTGTACTGCGGCAAGTGCTGCCAACACCTTCGTGT
ACGAGGTGCGGTGCGCCCGCCGGTGCCCCCAAGAAGTCGGGCGGCTGCCGCCGCTGCCGC
TGCCCCCGCCCCCGCTGCCGAGGCCGGCGGCAAGGGCAAGAAGGGCAAGAAGTAAATGGC
TGGCCCCACCGTTGCGTGCGCGCCCGCGGTGCGCTGCGCGGTCGGCAGCTTGGGTGTGGC
ATCCGGTGCGGCTTGTCCCGCCGGCATGTAGCTCTTATGTAACGGGCTGTCTGT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000022A_C01 KCC000022A_c01
         (714 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||JH0226 ubiquitin / ribosomal protein S27a.1 - barley gi|167...   121  1e-31
dbj|BAB39294.1| ubiquitin / ribosomal protein S27a [Oryza sativa...   121  1e-31
pir||JH0227 ubiquitin / ribosomal protein S27a.2 - barley gi|167...   121  1e-31
gb|AAA70104.1| ubiquitin fusion protein gi|1589387|prf||2211240A...   117  1e-30
pir||JS0657 ubiquitin / ribosomal protein S27a - maize gi|168651...   116  3e-30

>pir||JH0226 ubiquitin / ribosomal protein S27a.1 - barley
           gi|167073|gb|AAA62698.1| ubiquitin
          Length = 155

 Score =  121 bits (304), Expect(2) = 1e-31
 Identities = 58/85 (68%), Positives = 66/85 (77%), Gaps = 2/85 (2%)
 Frame = +2

Query: 215 VSDDSTLMCLLRLLGGAKKRKKKTYTKPKKQKHKHKKIKLRVLKFYKVD*LLARSSACCK 394
           +  +STL  +LRL GGAKKRKKKTYTKPKKQKHKHKK+KL VL+FYKVD    + +   K
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDATGKVTRLRK 120

Query: 395 QCPN--CGPGTFMATHFDRVYCGKC 463
           +CPN  CG GTFMA HFDR YCGKC
Sbjct: 121 ECPNADCGAGTFMANHFDRHYCGKC 145

 Score = 37.7 bits (86), Expect(2) = 1e-31
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 1/51 (1%)
 Frame = +3

Query: 57  LTGLT-SLR*VLAQTVADVKAAVEALQGLEAGEQRILFNGVQLEDSQVLAE 206
           LTG T +L    + T+ +VKA ++  +G+   +QR++F G QLED + LA+
Sbjct: 8   LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD 58

>dbj|BAB39294.1| ubiquitin / ribosomal protein S27a [Oryza sativa (japonica
           cultivar-group)]
          Length = 155

 Score =  121 bits (304), Expect(2) = 1e-31
 Identities = 58/85 (68%), Positives = 66/85 (77%), Gaps = 2/85 (2%)
 Frame = +2

Query: 215 VSDDSTLMCLLRLLGGAKKRKKKTYTKPKKQKHKHKKIKLRVLKFYKVD*LLARSSACCK 394
           +  +STL  +LRL GGAKKRKKKTYTKPKKQKHKHKK+KL VL+FYKVD    + +   K
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDATGKVTRLRK 120

Query: 395 QCPN--CGPGTFMATHFDRVYCGKC 463
           +CPN  CG GTFMA HFDR YCGKC
Sbjct: 121 ECPNAECGAGTFMANHFDRHYCGKC 145

 Score = 37.7 bits (86), Expect(2) = 1e-31
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 1/51 (1%)
 Frame = +3

Query: 57  LTGLT-SLR*VLAQTVADVKAAVEALQGLEAGEQRILFNGVQLEDSQVLAE 206
           LTG T +L    + T+ +VKA ++  +G+   +QR++F G QLED + LA+
Sbjct: 8   LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD 58

>pir||JH0227 ubiquitin / ribosomal protein S27a.2 - barley
           gi|167075|gb|AAA62699.1| ubiquitin
          Length = 155

 Score =  121 bits (303), Expect(2) = 1e-31
 Identities = 58/85 (68%), Positives = 66/85 (77%), Gaps = 2/85 (2%)
 Frame = +2

Query: 215 VSDDSTLMCLLRLLGGAKKRKKKTYTKPKKQKHKHKKIKLRVLKFYKVD*LLARSSACCK 394
           +  +STL  +LRL GGAKKRKKKTYTKPKKQKHKHKK+KL VL+FYKVD    + +   K
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDSTGKVTRLRK 120

Query: 395 QCPN--CGPGTFMATHFDRVYCGKC 463
           +CPN  CG GTFMA HFDR YCGKC
Sbjct: 121 ECPNADCGAGTFMANHFDRHYCGKC 145

 Score = 37.7 bits (86), Expect(2) = 1e-31
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 1/51 (1%)
 Frame = +3

Query: 57  LTGLT-SLR*VLAQTVADVKAAVEALQGLEAGEQRILFNGVQLEDSQVLAE 206
           LTG T +L    + T+ +VKA ++  +G+   +QR++F G QLED + LA+
Sbjct: 8   LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD 58

>gb|AAA70104.1| ubiquitin fusion protein gi|1589387|prf||2211240A ubiquitin fusion
           protein
          Length = 155

 Score =  117 bits (294), Expect(2) = 1e-30
 Identities = 56/85 (65%), Positives = 65/85 (75%), Gaps = 2/85 (2%)
 Frame = +2

Query: 215 VSDDSTLMCLLRLLGGAKKRKKKTYTKPKKQKHKHKKIKLRVLKFYKVD*LLARSSACCK 394
           +  +STL  +LRL GGAKKRKKKTYTKPKK KHKHKK+KL VL+FYKVD   ++ +   K
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKTYTKPKKTKHKHKKVKLSVLQFYKVDDTTSKVTRLRK 120

Query: 395 QCPN--CGPGTFMATHFDRVYCGKC 463
           +CPN  CG G FMA HFDR YCGKC
Sbjct: 121 ECPNSECGAGVFMANHFDRHYCGKC 145

 Score = 37.7 bits (86), Expect(2) = 1e-30
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 1/51 (1%)
 Frame = +3

Query: 57  LTGLT-SLR*VLAQTVADVKAAVEALQGLEAGEQRILFNGVQLEDSQVLAE 206
           LTG T +L    + T+ +VKA ++  +G+   +QR++F G QLED + LA+
Sbjct: 8   LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD 58

>pir||JS0657 ubiquitin / ribosomal protein S27a - maize gi|168651|gb|AAA33519.1|
           ubiquitin fusion protein gi|902527|gb|AAA70105.1|
           ubiquitin fusion protein gi|1589388|prf||2211240B
           ubiquitin fusion protein
          Length = 155

 Score =  116 bits (291), Expect(2) = 3e-30
 Identities = 56/85 (65%), Positives = 64/85 (74%), Gaps = 2/85 (2%)
 Frame = +2

Query: 215 VSDDSTLMCLLRLLGGAKKRKKKTYTKPKKQKHKHKKIKLRVLKFYKVD*LLARSSACCK 394
           +  +STL  +LRL GGAKKRKKKTYTKPKK KHKHKK+KL VL+FYKVD    + +   K
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRK 120

Query: 395 QCPN--CGPGTFMATHFDRVYCGKC 463
           +CPN  CG G FMA HFDR YCGKC
Sbjct: 121 ECPNTECGAGVFMANHFDRHYCGKC 145

 Score = 37.7 bits (86), Expect(2) = 3e-30
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 1/51 (1%)
 Frame = +3

Query: 57  LTGLT-SLR*VLAQTVADVKAAVEALQGLEAGEQRILFNGVQLEDSQVLAE 206
           LTG T +L    + T+ +VKA ++  +G+   +QR++F G QLED + LA+
Sbjct: 8   LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD 58



EST assemble image


clone accession position
1 HCL067c02_r AV643300 1 610
2 MX236f10_r BP091304 19 422
3 HCL076f04_r AV643817 29 643
4 MXL017d09_r BP094047 96 460
5 CM091h07_r AV397556 98 623
6 MXL040b06_r BP095336 99 530
7 MXL043b05_r BP095522 99 519
8 MXL040h10_r BP095381 99 515
9 MXL053f03_r BP096149 99 520
10 MXL020e08_r BP094282 99 563
11 HC055f01_r AV636134 99 633
12 MXL069b05_r BP097043 101 622
13 MXL036b01_r BP095115 101 650
14 HC050a03_r AV635717 102 351
15 HC081f10_r AV638081 102 470
16 MXL079d08_r BP097673 102 239
17 HC036h02_r AV634712 102 643
18 MXL077f10_r BP097555 102 517
19 MXL061g07_r BP096613 102 526
20 CL45e11_r AV397799 103 560
21 MX259e02_r BP092810 103 558
22 LCL050f08_r AV629030 103 627
23 LC055e11_r AV622851 105 609
24 MXL039d01_r BP095284 105 262
25 MX039e10_r BP087627 105 604
26 CS001g02_r AV397983 105 586
27 HC099f07_r AV639459 105 623
28 MXL043e09_r BP095542 105 592
29 LCL033h03_r AV627918 105 562
30 MXL066h04_r BP096907 105 558
31 MX001e09_r BP086081 105 566
32 MXL020d01_r BP094268 107 644
33 LC063c04_r AV623401 107 345
34 MXL068b12_r BP096984 108 568
35 MX259a05_r BP092778 109 562
36 MXL074c03_r BP097347 110 509
37 CL36a06_r AV395116 110 669
38 MX025c10_r BP087100 110 498
39 HCL033e12_r AV641437 110 656
40 MXL037h01_r BP095198 112 425
41 HC057a07_r AV636249 112 508
42 MXL069f08_r BP097079 112 621
43 HC041b06_r AV635040 112 609
44 LC075c02_r AV624260 113 620
45 MXL054g09_r BP096219 115 568
46 HC070f12_r AV637253 117 671
47 MX239b08_r BP091461 117 443
48 MX005b04_r BP086252 117 528
49 HCL071a12_r AV643520 119 653
50 MX033h06_r BP087408 121 623
51 MXL030c10_r BP094818 124 340
52 MXL075c10_r BP097413 125 575
53 MX004c09_r BP086216 133 333
54 MXL055a12_r BP096238 203 640
55 HCL031a10_r AV641286 222 627
56 CS001e09_r AV398018 234 703
57 CL18b09_r AV394059 247 745
58 CL74c05_r AV396467 247 793
59 CL48c07_r AV395811 248 781
60 CM041h04_r AV389418 252 852
61 CL01f06_r AV393352 254 836
62 HC092e12_r AV638918 261 729
63 CL32b11_r AV394880 265 805
64 CL01e07_r AV393324 282 620
65 CL66d01_r AV396737 295 719
66 CL35g08_r AV395095 298 862
67 CM016a11_r AV387438 298 952
68 CL19b06_r AV394157 301 818
69 CL16g10_r AV394007 333 846
70 CL63d02_r AV396530 335 801
71 HCL099f12_r AV645215 513 856




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research