KCC000021A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000021A_C01 KCC000021A_c01
TGAAGCGGCACGTGTTCGTCTTCAGCACCATCTTCTGGTCTAAAGATGAGGCCATGGTGA
AGTTCCTGAAGCCTGGGAAGGTTGTCATCCTTCTGTCCGGCCGCTATGCCGGCATGAAGG
CCGTGATTGTGGCCAACAAGGACGACGGCTCGTCGGTGCGGCCATATGGCCATGCCACCG
TCGTGGGCCTGGCCAAGGAGCCCCGGAAGGTCATCAAGAAGATTAGCCAGAAGAAGCAGG
CTCGTCGCTCGAGCATCAAGACTTTCGTCAAGACCGTCAACTACCAGCACATCATGCCCA
CCCGCTACACCCTGGACGTGGACCTGAAGGCCGTCGTGGCCCCCGAGGCCATTGAGTCCG
CCGCCAAGAAGACGGACGCCCGCAAGGAGTGCAAGAAGCTGCTGGAGGAGAAGTTCAAGT
CGGGCAAGAACCGGTGGTTCTTCAGCAAGCTCCGCTTCTAAGCGTGTCGCACGATGCACT
GTGCGGGGCGTGTCGCGTGTTGTGACTTGTAACGGCTGATGAGGCTCTCCGACCGGCCCG
TCCTGCACCCCGCTCCTTTCGTAACAGCCCCACTGCGCAGCCCCCGTAAC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000021A_C01 KCC000021A_c01
         (590 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|Q02984|RL27_PYRST 60S RIBOSOMAL PROTEIN L27 gi|282737|pir||S2...   206  1e-52
pir||T06426 ribosomal protein L27 - garden pea gi|498902|gb|AAA8...   183  2e-45
sp|Q05462|RL27_PEA 60S RIBOSOMAL PROTEIN L27 gi|7441036|pir||T06...   182  2e-45
pir||T06431 ribosomal protein L27-5 - garden pea gi|498906|gb|AA...   182  2e-45
pir||T06430 ribosomal protein L27-4 - garden pea gi|498904|gb|AA...   179  3e-44

>sp|Q02984|RL27_PYRST 60S RIBOSOMAL PROTEIN L27 gi|282737|pir||S26612 ribosomal protein
           L27.e, cytosolic - green alga (Pyrobotrys stellata)
           gi|18267|emb|CAA48289.1| ribosomal protein L27
           [Pyrobotrys stellata]
          Length = 134

 Score =  206 bits (525), Expect = 1e-52
 Identities = 102/135 (75%), Positives = 117/135 (86%)
 Frame = +3

Query: 54  MVKFLKPGKVVILLSGRYAGMKAVIVANKDDGSSVRPYGHATVVGLAKEPRKVIKKISQK 233
           MVKFLK GKVV++LSGR+AG KAVIV N DDG+S RPYGHA VVGL KEPRKV K+ SQK
Sbjct: 1   MVKFLKSGKVVVVLSGRFAGKKAVIVRNFDDGTSSRPYGHALVVGLQKEPRKVTKRQSQK 60

Query: 234 KQARRSSIKTFVKTVNYQHIMPTRYTLDVDLKAVVAPEAIESAAKKTDARKECKKLLEEK 413
           KQA++S++KTF+KTVNY H+MPTRYTLDVD K V A EA E+  KK +ARKECKKLLEEK
Sbjct: 61  KQAKKSTLKTFIKTVNYNHLMPTRYTLDVDFKGVAA-EAQENPTKKVEARKECKKLLEEK 119

Query: 414 FKSGKNRWFFSKLRF 458
           FK+GKNRWFF+KLRF
Sbjct: 120 FKTGKNRWFFTKLRF 134

>pir||T06426 ribosomal protein L27 - garden pea gi|498902|gb|AAA86950.1|
           ribosomal protein L27 homolog
          Length = 135

 Score =  183 bits (464), Expect = 2e-45
 Identities = 90/135 (66%), Positives = 103/135 (75%)
 Frame = +3

Query: 54  MVKFLKPGKVVILLSGRYAGMKAVIVANKDDGSSVRPYGHATVVGLAKEPRKVIKKISQK 233
           MVKFLKP K VILL GRYAG KAVIV   DDG+  +PYGH  V G+ K P KVIKK S K
Sbjct: 1   MVKFLKPNKAVILLQGRYAGKKAVIVKTFDDGTREKPYGHCLVAGIKKYPSKVIKKDSAK 60

Query: 234 KQARRSSIKTFVKTVNYQHIMPTRYTLDVDLKAVVAPEAIESAAKKTDARKECKKLLEEK 413
           K A++S +K FVK VNYQH+MPTRYTLDVDLK  V P+ ++S  KK  A KE KK LEE+
Sbjct: 61  KTAKKSRVKAFVKLVNYQHLMPTRYTLDVDLKDAVVPDVLQSKDKKVTALKETKKSLEER 120

Query: 414 FKSGKNRWFFSKLRF 458
           FK+GKNRWFF+KLRF
Sbjct: 121 FKTGKNRWFFTKLRF 135

>sp|Q05462|RL27_PEA 60S RIBOSOMAL PROTEIN L27 gi|7441036|pir||T06451 ribosomal protein
           L27 - garden pea gi|20768|emb|CAA50035.1| ribosomal
           protein L27 [Pisum sativum]
          Length = 135

 Score =  182 bits (463), Expect = 2e-45
 Identities = 90/135 (66%), Positives = 103/135 (75%)
 Frame = +3

Query: 54  MVKFLKPGKVVILLSGRYAGMKAVIVANKDDGSSVRPYGHATVVGLAKEPRKVIKKISQK 233
           MVKFLKP K VILL GRYAG KAVIV   DDG+  +PYGH  V G+ K P KVIKK S K
Sbjct: 1   MVKFLKPNKAVILLQGRYAGKKAVIVKTFDDGTREKPYGHCLVAGIKKFPSKVIKKDSAK 60

Query: 234 KQARRSSIKTFVKTVNYQHIMPTRYTLDVDLKAVVAPEAIESAAKKTDARKECKKLLEEK 413
           K A++S +K FVK VNYQH+MPTRYTLDVDLK  V P+ ++S  KK  A KE KK LEE+
Sbjct: 61  KTAKKSRVKAFVKLVNYQHLMPTRYTLDVDLKDAVVPDVLQSKDKKVTALKETKKSLEER 120

Query: 414 FKSGKNRWFFSKLRF 458
           FK+GKNRWFF+KLRF
Sbjct: 121 FKTGKNRWFFTKLRF 135

>pir||T06431 ribosomal protein L27-5 - garden pea gi|498906|gb|AAA86952.1|
           ribosomal protein L27 homolog
          Length = 135

 Score =  182 bits (463), Expect = 2e-45
 Identities = 90/135 (66%), Positives = 103/135 (75%)
 Frame = +3

Query: 54  MVKFLKPGKVVILLSGRYAGMKAVIVANKDDGSSVRPYGHATVVGLAKEPRKVIKKISQK 233
           MVKFLKP K VILL GRYAG KAVIV   DDG+  +PYGH  V G+ K P KVIKK S K
Sbjct: 1   MVKFLKPNKAVILLQGRYAGKKAVIVKTFDDGTRDKPYGHCLVAGIKKYPSKVIKKDSAK 60

Query: 234 KQARRSSIKTFVKTVNYQHIMPTRYTLDVDLKAVVAPEAIESAAKKTDARKECKKLLEEK 413
           K A++S +K FVK VNYQH+MPTRYTLDVDLK  V P+ ++S  KK  A KE KK LEE+
Sbjct: 61  KTAKKSRVKAFVKLVNYQHLMPTRYTLDVDLKDAVVPDVLQSKDKKVTALKETKKSLEER 120

Query: 414 FKSGKNRWFFSKLRF 458
           FK+GKNRWFF+KLRF
Sbjct: 121 FKTGKNRWFFTKLRF 135

>pir||T06430 ribosomal protein L27-4 - garden pea gi|498904|gb|AAA86951.1|
           ribosomal protein L27 homolog
          Length = 135

 Score =  179 bits (453), Expect = 3e-44
 Identities = 88/135 (65%), Positives = 102/135 (75%)
 Frame = +3

Query: 54  MVKFLKPGKVVILLSGRYAGMKAVIVANKDDGSSVRPYGHATVVGLAKEPRKVIKKISQK 233
           MVKFLKP K VILL GRYAG KAVIV   DDG+  +PYGH  V G+ K   KVIKK S K
Sbjct: 1   MVKFLKPNKAVILLQGRYAGKKAVIVKTFDDGTREKPYGHCLVAGIKKYSSKVIKKDSAK 60

Query: 234 KQARRSSIKTFVKTVNYQHIMPTRYTLDVDLKAVVAPEAIESAAKKTDARKECKKLLEEK 413
           K A++S +K FVK VNYQH+MPTRYTLDVDLK  V P+ ++S  KK  A KE KK +EE+
Sbjct: 61  KTAKKSRVKAFVKLVNYQHLMPTRYTLDVDLKDAVVPDVLQSKDKKVTALKETKKSVEER 120

Query: 414 FKSGKNRWFFSKLRF 458
           FK+GKNRWFF+KLRF
Sbjct: 121 FKTGKNRWFFTKLRF 135



EST assemble image


clone accession position
1 HC078g12_r AV637879 1 617
2 MXL084h10_r BP097995 9 363
3 CL30e09_r AV394770 13 609
4 CL21d07_r AV394346 14 601
5 CL68d05_r AV396918 15 492
6 CL64b11_r AV396666 19 611
7 CL35d09_r AV395079 19 611
8 CL33d05_r AV394970 20 620
9 CL06e07_r AV393614 32 594
10 CM092d11_r AV392651 67 612
11 CL26a04_r AV394570 97 634
12 CM087b10_r AV392468 98 632
13 CL79c06_r AV397174 101 611
14 CM093c07_r AV392988 101 606
15 CM013f08_r AV387084 103 420
16 HC072d10_r AV637381 103 285
17 CL60d06_r AV396363 103 612
18 CL32b12_r AV394868 103 612
19 HCL093g08_r AV644788 103 498
20 CL11g02_r AV393757 103 611
21 MXL092b04_r BP098355 103 528
22 LCL030g09_r AV627704 103 477
23 CM039b08_r AV388988 103 677
24 CL53c05_r AV395971 103 613
25 HCL069d05_r AV643419 103 583
26 LC007e08_r AV619377 103 619
27 CL79b06_r AV397172 104 591
28 CM001b02_r AV386496 104 639
29 CL48b08_r AV395801 104 602
30 MXL059a05_r BP096453 104 502
31 CL70c09_r AV396862 104 612
32 CL35f12_r AV395062 104 613
33 CL06d08_r AV393605 104 596
34 CL60a09_r AV396379 104 612
35 LC008f12_r AV619466 104 611
36 LC050b09_r AV622471 104 613
37 CL08g11_r AV393549 104 628
38 CL60a04_r AV396393 104 619
39 CL49c11_r AV397711 104 617
40 HC020a08_r AV633371 105 609
41 CL03a06_r AV393400 106 611
42 CL35g05_r AV395076 107 612
43 CL29c09_r AV394667 108 608
44 HCL063f05_r AV643093 109 612
45 CL15d06_r AV393974 109 590
46 CL67c05_r AV396686 109 611
47 CS001b01_r AV398000 110 639
48 CL56d09_r AV396112 110 611
49 CL78f10_r AV397243 111 613
50 HC092b05_r AV638890 111 351
51 CL25f10_r AV394559 113 591
52 CL29c07_r AV394642 113 584
53 CL01e01_r AV393342 115 627
54 LC096f01_r AV625697 115 582
55 LC090d10_r AV625287 116 612
56 CL58c02_r AV396191 118 613
57 CL38b02_r AV395284 118 584
58 CL48d04_r AV395800 118 611
59 CL48h05_r AV395789 118 626
60 CL50a08_r AV395766 118 602
61 CL32e10_r AV394847 119 615
62 MX104g10_r BP089102 119 612
63 CL30h04_r AV394736 122 617
64 CL38d07_r AV395310 124 612
65 CL04b05_r AV393381 124 611
66 MX102g04_r BP088924 125 612
67 CL49c02_r AV397759 125 612
68 CL19c08_r AV394207 125 596
69 CL69g06_r AV396790 126 611
70 CL23d07_r AV394479 132 619
71 MX104f06_r BP089087 137 612
72 CL28a03_r AV394779 149 613
73 MX104h04_r BP089107 151 612
74 MX101h12_r BP088861 180 612
75 LCL045f01_r AV628684 194 480
76 CL20d08_r AV394333 203 610
77 HCL100h11_r AV645312 211 523
78 MX101c02_r BP088801 212 612
79 MX103b10_r BP088963 215 612
80 MX103f07_r BP089001 283 612
81 MX101e03_r BP088822 368 611




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research