KCC000020A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000020A_C01 KCC000020A_c01
TGAGCTTACCTGGCACACATTGACGCCCCTATATAAGCGCTTGACGCTTCTAGCGCTCCT
AGCGACCAACAAACTTTTAGCGACTGGCGAAGCCGCTCACTTCAGCGCTCGGTGCAGGAT
GCAGACTTGCATGTCTCCTCCCGGCACTAGCCGATCAGCGGCGCTGCCTCAGCGGACGGC
AGCGCCCAACGCGGCGCGGCTGGGTGTCACTCAGAACGGCCTCGCAAGCCCCAGCGGACG
CGGTGCTCGATGCGTTCCTGCGCGCGGGCGACGGTCGCCTGAGCGACGTGCAGCGTGACC
TCCTTGCAGAGATCGAGGCACGTCGCAAGAATCAAGCTCAGCTCCTTGAGAAACTTAACC
GCTTGGCCGCTGAAACGGCCGCGCGCACCGCTGCCACGCCCGCTTCGGCTGCTCCCCCAG
CCCCGCCTGCAGCGGCCATGCCGGCCCCCGCTCCCGAGGTGCAGGTCGCTGTCCCCATGT
CCGTGCCCATGCCGGCAATGGCCTCAGTGGCCTCGTCCCCGTCCTCGGCGTGGAAGTCCG
TGCCTGTCTCGCAGCCGGTCCGCACTGCTCCCCCGCCTCCGCCACCCACCCCGTCGGTGC
CCATCTTCGAGCTGTCCCTGCCGCTGGAGTCGGAGATGTACATTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000020A_C01 KCC000020A_c01
         (645 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAB95309.1| hypothetical protein L3302.06 [Leishmania major]       59  8e-08
ref|NP_509224.1| GRounDhog, hedgehog-like (grd-7) [Caenorhabditi...    56  4e-07
gb|AAD03499.2| serine/threonine protein kinase PpkA [Pseudomonas...    55  7e-07
ref|NP_248764.1| serine/threonine protein kinase PpkA [Pseudomon...    55  7e-07
ref|NP_767161.1| blr0521 [Bradyrhizobium japonicum] gi|27348769|...    55  1e-06

>emb|CAB95309.1| hypothetical protein L3302.06 [Leishmania major]
          Length = 762

 Score = 58.5 bits (140), Expect = 8e-08
 Identities = 41/89 (46%), Positives = 49/89 (54%), Gaps = 9/89 (10%)
 Frame = +3

Query: 363 LAAETAARTAATPAS------AAPPAPPAAAMPAPAPEVQVAVP---MSVPMPAMASVAS 515
           LAA+TA  TA+TPAS      +APP PPAA++P P P   V  P   +SVP P  A    
Sbjct: 327 LAAKTA--TASTPASPPPPAASAPPPPPAASVPPPPPAASVPPPPPAVSVPPPPRAMSIP 384

Query: 516 SPSSAWKSVPVSQPVRTAPPPPPPTPSVP 602
            P  A  S+P   P   + PPPPP  SVP
Sbjct: 385 LPPPA-ASIPPPLPA-VSVPPPPPAASVP 411

 Score = 39.7 bits (91), Expect = 0.038
 Identities = 29/79 (36%), Positives = 38/79 (47%)
 Frame = +3

Query: 366 AAETAARTAATPASAAPPAPPAAAMPAPAPEVQVAVPMSVPMPAMASVASSPSSAWKSVP 545
           A    A T  + ++AA  AP  AA  A A     + P S P PA ++    P++   SVP
Sbjct: 306 APGVTALTGTSASAAAAVAPGLAAKTATA-----STPASPPPPAASAPPPPPAA---SVP 357

Query: 546 VSQPVRTAPPPPPPTPSVP 602
              P  + PPPPP   SVP
Sbjct: 358 PPPPAASVPPPPPAV-SVP 375

 Score = 35.8 bits (81), Expect = 0.55
 Identities = 18/41 (43%), Positives = 22/41 (52%)
 Frame = +3

Query: 399 PASAAPPAPPAAAMPAPAPEVQVAVPMSVPMPAMASVASSP 521
           PA + PP PPAA++P P P V V      P P  AS   +P
Sbjct: 397 PAVSVPPPPPAASVPPPLPAVSVP-----PPPRSASALKTP 432

 Score = 32.3 bits (72), Expect = 6.1
 Identities = 25/81 (30%), Positives = 33/81 (39%), Gaps = 1/81 (1%)
 Frame = +3

Query: 384 RTAATPASAAPPAPPAAAMPAPAPEVQVAVPMSVPMPAMASVASSPSSAWKSVPVSQPVR 563
           +T A P   A     A+A  A AP +           A AS  +SP     S P   P  
Sbjct: 302 KTGAAPGVTALTGTSASAAAAVAPGLAAKT-------ATASTPASPPPPAASAPPPPPAA 354

Query: 564 TAPPPPPP-TPSVPIFELSLP 623
           + PPPPP  +   P   +S+P
Sbjct: 355 SVPPPPPAASVPPPPPAVSVP 375

>ref|NP_509224.1| GRounDhog, hedgehog-like (grd-7) [Caenorhabditis elegans]
           gi|7503611|pir||T34279 hypothetical protein F46H5.6 -
           Caenorhabditis elegans gi|1695235|gb|AAB37027.1|
           Groundhog (hedgehog-like family) protein 7
           [Caenorhabditis elegans]
          Length = 416

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 35/82 (42%), Positives = 42/82 (50%), Gaps = 12/82 (14%)
 Frame = +3

Query: 393 ATPASAAPPAP-PAAAMPAPAPEV----QVAVPMSVPMPAMASVASSPSSA-------WK 536
           A PA A PPAP P  A+PAPAP +    Q AVP+  P PA     + P+ A         
Sbjct: 76  AVPAPAPPPAPYPQHAVPAPAPPLASYPQNAVPVPAPPPAPYPQHAVPAPAPPPAPYPQH 135

Query: 537 SVPVSQPVRTAPPPPPPTPSVP 602
           +VP   P +  PPPPPP P  P
Sbjct: 136 AVPAPAPYQQQPPPPPPPPHYP 157

 Score = 41.2 bits (95), Expect = 0.013
 Identities = 28/77 (36%), Positives = 32/77 (41%), Gaps = 7/77 (9%)
 Frame = +3

Query: 393 ATPASAAPPAP-PAAAMPAPAPEVQVAVP------MSVPMPAMASVASSPSSAWKSVPVS 551
           A PA A PPAP P  A+PAPAP  Q   P         P P       +P SA+      
Sbjct: 121 AVPAPAPPPAPYPQHAVPAPAPYQQQPPPPPPPPHYPPPPPHYPPPPPAPHSAYIDHSAP 180

Query: 552 QPVRTAPPPPPPTPSVP 602
           +P       PPP P  P
Sbjct: 181 RPAYIEHSAPPPQPQYP 197

 Score = 38.5 bits (88), Expect = 0.085
 Identities = 25/82 (30%), Positives = 29/82 (34%)
 Frame = +3

Query: 378 AARTAATPASAAPPAPPAAAMPAPAPEVQVAVPMSVPMPAMASVASSPSSAWKSVPVSQP 557
           +A  A TP    PP PP    PAP  E       + P P  A        A    P   P
Sbjct: 32  SAPAATTPQ---PPPPPPPPKPAPYVEQSAQPQQTAPPPPPAPYPQQAVPAPAPPPAPYP 88

Query: 558 VRTAPPPPPPTPSVPIFELSLP 623
               P P PP  S P   + +P
Sbjct: 89  QHAVPAPAPPLASYPQNAVPVP 110

 Score = 32.3 bits (72), Expect = 6.1
 Identities = 20/70 (28%), Positives = 25/70 (35%)
 Frame = +3

Query: 414 PPAPPAAAMPAPAPEVQVAVPMSVPMPAMASVASSPSSAWKSVPVSQPVRTAPPPPPPTP 593
           P + PAA  P P P      P   P P +   A    +A    P   P +  P P PP  
Sbjct: 30  PESAPAATTPQPPPPP----PPPKPAPYVEQSAQPQQTAPPPPPAPYPQQAVPAPAPPPA 85

Query: 594 SVPIFELSLP 623
             P   +  P
Sbjct: 86  PYPQHAVPAP 95

>gb|AAD03499.2| serine/threonine protein kinase PpkA [Pseudomonas aeruginosa]
          Length = 1032

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 40/117 (34%), Positives = 56/117 (47%), Gaps = 7/117 (5%)
 Frame = +3

Query: 273 GRLSDVQRDLLAEIEARRKNQA-QLLEKLNRLAAE----TAARTAATPASAAPPAPPAAA 437
           GR  D+ R LLA+  A R   A  L+  L+RLA      T  R  ATP  +   + P  A
Sbjct: 231 GRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQGSPRASNPPPA 290

Query: 438 MPAPAPEVQVA--VPMSVPMPAMASVASSPSSAWKSVPVSQPVRTAPPPPPPTPSVP 602
            PAP P   +    P+S+ +P +     +PS+   + P   P + A PP PP P +P
Sbjct: 291 EPAPMPPADLGGLQPVSIQLPPV-----TPSAGGATPPPPPPSQAAKPPSPPPPPLP 342

>ref|NP_248764.1| serine/threonine protein kinase PpkA [Pseudomonas aeruginosa PA01]
           gi|11352565|pir||D83637 serine/threonine protein kinase
           PpkA PA0074 [imported] - Pseudomonas aeruginosa (strain
           PAO1) gi|9945898|gb|AAG03464.1|AE004446_12
           serine/threonine protein kinase PpkA [Pseudomonas
           aeruginosa PAO1]
          Length = 1032

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 40/117 (34%), Positives = 56/117 (47%), Gaps = 7/117 (5%)
 Frame = +3

Query: 273 GRLSDVQRDLLAEIEARRKNQA-QLLEKLNRLAAE----TAARTAATPASAAPPAPPAAA 437
           GR  D+ R LLA+  A R   A  L+  L+RLA      T  R  ATP  +   + P  A
Sbjct: 231 GRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQGSPRASNPPPA 290

Query: 438 MPAPAPEVQVA--VPMSVPMPAMASVASSPSSAWKSVPVSQPVRTAPPPPPPTPSVP 602
            PAP P   +    P+S+ +P +     +PS+   + P   P + A PP PP P +P
Sbjct: 291 EPAPLPPADLGGLQPVSIQLPPV-----TPSAGGATPPPPPPSQAAKPPSPPPPPLP 342

>ref|NP_767161.1| blr0521 [Bradyrhizobium japonicum] gi|27348769|dbj|BAC45786.1|
           blr0521 [Bradyrhizobium japonicum USDA 110]
          Length = 745

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 32/74 (43%), Positives = 34/74 (45%)
 Frame = +3

Query: 381 ARTAATPASAAPPAPPAAAMPAPAPEVQVAVPMSVPMPAMASVASSPSSAWKSVPVSQPV 560
           AR AA P +AAPP PPAA  PA AP    A P   P PA                     
Sbjct: 65  ARPAAPPPAAAPPHPPAAPPPAAAPPRPAAPPPPPPPPA--------------------A 104

Query: 561 RTAPPPPPPTPSVP 602
           R APPPPPP P+ P
Sbjct: 105 RPAPPPPPPPPAAP 118

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 28/68 (41%), Positives = 32/68 (46%)
 Frame = +3

Query: 390 AATPASAAPPAPPAAAMPAPAPEVQVAVPMSVPMPAMASVASSPSSAWKSVPVSQPVRTA 569
           AA P +AAPP P A   P P P  + A P   P PA     S P       P + P + A
Sbjct: 81  AAPPPAAAPPRPAAPPPPPPPPAARPAPPPPPPPPAAPKQPSPP-------PAAAPQQHA 133

Query: 570 PPPPPPTP 593
           P PPPP P
Sbjct: 134 PTPPPPAP 141

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 32/93 (34%), Positives = 39/93 (41%), Gaps = 14/93 (15%)
 Frame = +3

Query: 366 AAETAARTAATPASAAPPAPPAAAMPAPAPEVQ--VAVPMSVPMPAMASVASSPSSAWKS 539
           AA   A     PA+  PP PP AA PAP P      A     P PA A    +P+    +
Sbjct: 81  AAPPPAAAPPRPAAPPPPPPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPPA 140

Query: 540 VPVSQPVRT------------APPPPPPTPSVP 602
            P ++P  T            APPPPPP  + P
Sbjct: 141 PPAARPAPTPPAPPPAAAPQHAPPPPPPPAARP 173

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 30/78 (38%), Positives = 36/78 (45%), Gaps = 7/78 (8%)
 Frame = +3

Query: 390 AATPASAAPPAPPA--AAMPAPAPEVQ---VAVPMSVPM--PAMASVASSPSSAWKSVPV 548
           AA P    PP PPA  AA P PAP      VA P + P   P   + A++P+      P 
Sbjct: 170 AARPTPTPPPPPPAGPAARPTPAPTATPTPVAPPPAAPTARPGSPAPAATPAPTPTPAPT 229

Query: 549 SQPVRTAPPPPPPTPSVP 602
           + P  TA P P  TP  P
Sbjct: 230 ATPAPTATPAPGSTPGAP 247

 Score = 45.8 bits (107), Expect = 5e-04
 Identities = 29/74 (39%), Positives = 34/74 (45%)
 Frame = +3

Query: 369 AETAARTAATPASAAPPAPPAAAMPAPAPEVQVAVPMSVPMPAMASVASSPSSAWKSVPV 548
           A  AAR A TP +  P A P  A P P P      P + P P  A  A+ P+ A    P 
Sbjct: 140 APPAARPAPTPPAPPPAAAPQHAPPPPPPPAARPTP-TPPPPPPAGPAARPTPA----PT 194

Query: 549 SQPVRTAPPPPPPT 590
           + P   APPP  PT
Sbjct: 195 ATPTPVAPPPAAPT 208

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 29/85 (34%), Positives = 36/85 (42%), Gaps = 16/85 (18%)
 Frame = +3

Query: 390 AATPASAAPPAPPAAAM-----PAPAPEVQVAVPMSVPMPAMASVASSPSSAWKSV---- 542
           AA PA   PP PPAA       PA AP+     P   P P  A  A +P +   +     
Sbjct: 103 AARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPP-PAPPAARPAPTPPAPPPAAAPQH 161

Query: 543 -------PVSQPVRTAPPPPPPTPS 596
                  P ++P  T PPPPP  P+
Sbjct: 162 APPPPPPPAARPTPTPPPPPPAGPA 186

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 24/78 (30%), Positives = 29/78 (36%), Gaps = 9/78 (11%)
 Frame = +3

Query: 390 AATPASAAPPAPPAAAMPAPAPEVQ---------VAVPMSVPMPAMASVASSPSSAWKSV 542
           AA P  A PP PP AA P P P               P + P P     A+  +      
Sbjct: 156 AAAPQHAPPPPPPPAARPTPTPPPPPPAGPAARPTPAPTATPTPVAPPPAAPTARPGSPA 215

Query: 543 PVSQPVRTAPPPPPPTPS 596
           P + P  T  P P  TP+
Sbjct: 216 PAATPAPTPTPAPTATPA 233

 Score = 39.3 bits (90), Expect = 0.050
 Identities = 29/93 (31%), Positives = 34/93 (36%), Gaps = 16/93 (17%)
 Frame = +3

Query: 366 AAETAARTAATPASAAPP---------APPAAAMPAPAP-EVQVAVPMSVPMPAMASVAS 515
           AA       ATP   APP         +P  AA PAP P     A P     PA  S   
Sbjct: 186 AARPTPAPTATPTPVAPPPAAPTARPGSPAPAATPAPTPTPAPTATPAPTATPAPGSTPG 245

Query: 516 SPSSAWKSVPV------SQPVRTAPPPPPPTPS 596
           +P +     P       S P   +PP P  TP+
Sbjct: 246 APPAGRPGAPPPGVRPGSPPAAGSPPAPGATPA 278

 Score = 38.5 bits (88), Expect = 0.085
 Identities = 26/81 (32%), Positives = 32/81 (39%), Gaps = 5/81 (6%)
 Frame = +3

Query: 366 AAETAARTAATPASAAPPAPPAAAMP--APAPEVQVAVPMSVPMPAMASVASSPSSAWKS 539
           A     R  + PA+ +PPAP A   P   PAP      P   P PA      + + A  +
Sbjct: 254 APPPGVRPGSPPAAGSPPAPGATPAPTTTPAPGGTATPPSGRPGPASTPAPGAATPAPTA 313

Query: 540 VPVSQPVRTAPPPPP---PTP 593
            P      T PP  P   PTP
Sbjct: 314 TPAPGGALTPPPGRPGAGPTP 334

 Score = 38.1 bits (87), Expect = 0.11
 Identities = 29/83 (34%), Positives = 31/83 (36%), Gaps = 5/83 (6%)
 Frame = +3

Query: 369 AETAARTAATPASAAPPAPPA----AAMPAPAPE-VQVAVPMSVPMPAMASVASSPSSAW 533
           A TA  T   P  AAP A P     AA PAP P     A P     PA  S   +P +  
Sbjct: 192 APTATPTPVAPPPAAPTARPGSPAPAATPAPTPTPAPTATPAPTATPAPGSTPGAPPAGR 251

Query: 534 KSVPVSQPVRTAPPPPPPTPSVP 602
              P   P    P  PP   S P
Sbjct: 252 PGAP---PPGVRPGSPPAAGSPP 271

 Score = 34.7 bits (78), Expect = 1.2
 Identities = 29/96 (30%), Positives = 34/96 (35%), Gaps = 13/96 (13%)
 Frame = +3

Query: 375 TAARTAATPASAAPPAPPAAAMPAPAPEVQV-------------AVPMSVPMPAMASVAS 515
           T A TA     + P APPA    AP P V+              A P     PA    A+
Sbjct: 231 TPAPTATPAPGSTPGAPPAGRPGAPPPGVRPGSPPAAGSPPAPGATPAPTTTPAPGGTAT 290

Query: 516 SPSSAWKSVPVSQPVRTAPPPPPPTPSVPIFELSLP 623
            PS   +  P S P   A  P P     P   L+ P
Sbjct: 291 PPSG--RPGPASTPAPGAATPAPTATPAPGGALTPP 324

 Score = 34.7 bits (78), Expect = 1.2
 Identities = 24/80 (30%), Positives = 32/80 (40%), Gaps = 1/80 (1%)
 Frame = +3

Query: 369 AETAARTAATPASAAPPAPPAAAMPAPAPEVQVAVPMSVPMPAMASVAS-SPSSAWKSVP 545
           A  A   AA P +   PA PAA   A AP        + P P  A  A  + + A+++ P
Sbjct: 345 APAAGTPAAPPQAGGLPARPAAPAGAAAPSTVPGSAAATPPPNRAQFAPPTVTPAFQAAP 404

Query: 546 VSQPVRTAPPPPPPTPSVPI 605
                   PP PP     P+
Sbjct: 405 TVVAPLPPPPRPPQRDLTPL 424

 Score = 34.3 bits (77), Expect = 1.6
 Identities = 34/118 (28%), Positives = 42/118 (34%), Gaps = 43/118 (36%)
 Frame = +3

Query: 369 AETAARTAATPASAAPPAPPAAAMP---------------------APAPEVQVAVPMSV 485
           A T A  AATPA  A PAP  A  P                     APA     A P + 
Sbjct: 299 ASTPAPGAATPAPTATPAPGGALTPPPGRPGAGPTPGPQGGTPPAGAPAAGTPAAPPQAG 358

Query: 486 PMPA-------MASVASSPSSAWKSVPVSQ---------------PVRTAPPPPPPTP 593
            +PA        A+ ++ P SA  + P ++               P   AP PPPP P
Sbjct: 359 GLPARPAAPAGAAAPSTVPGSAAATPPPNRAQFAPPTVTPAFQAAPTVVAPLPPPPRP 416

 Score = 34.3 bits (77), Expect = 1.6
 Identities = 25/96 (26%), Positives = 30/96 (31%), Gaps = 17/96 (17%)
 Frame = +3

Query: 366 AAETAARTAATPASAAPPAPPAAAMP---------APAPEVQVAVPMSVPMPAMA----- 503
           AA +     ATPA    PAP   A P          PAP      P + P P  A     
Sbjct: 266 AAGSPPAPGATPAPTTTPAPGGTATPPSGRPGPASTPAPGAATPAPTATPAPGGALTPPP 325

Query: 504 ---SVASSPSSAWKSVPVSQPVRTAPPPPPPTPSVP 602
                  +P     + P   P    P  PP    +P
Sbjct: 326 GRPGAGPTPGPQGGTPPAGAPAAGTPAAPPQAGGLP 361



EST assemble image


clone accession position
1 CL01d12_r AV393301 1 510
2 HCL073c09_r AV643645 1 414
3 MXL051g01_r BP096050 1 379
4 HCL057d07_r AV642761 1 492
5 HCL088e02_r AV644435 5 532
6 MXL077c10_r BP097526 5 371
7 MXL066g05_r BP096901 5 401
8 HCL052e02_r AV642475 9 482
9 HCL056d10_r AV642707 10 294
10 LCL038f10_r AV628224 10 146
11 LCL077f12_r AV630353 10 473
12 HCL015h07_r AV640418 12 291
13 HCL055e09_r AV642659 12 482
14 LCL066d11_r AV629804 13 453
15 MXL026h12_r BP094672 14 148
16 MXL091d09_r BP098317 14 377
17 HCL009h01_r AV640074 16 427
18 HCL095b10_r AV644893 26 481
19 HCL007e06_r AV639937 45 444
20 CL42e05_r AV395465 76 532
21 LCL038h06_r AV628236 79 344
22 MXL005c03_r BP093223 86 528
23 HCL004d12_r AV639754 96 557
24 CL24f06_r AV394450 229 614
25 LCL020c04_r AV627044 259 642
26 LCL041e03_r AV628419 332 646
27 LCL038a09_r AV628189 377 549




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research